KEGG   Ricinus communis (castor bean): RCOM_1052220Help
Entry
RCOM_1052220      CDS       T01087                                 

Definition
3-hydroxyacyl-CoA dehyrogenase, putative (EC:5.1.2.3)
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RCOM_1052220
  Lipid metabolism
   00071 Fatty acid degradation
    RCOM_1052220
   00592 alpha-Linolenic acid metabolism
    RCOM_1052220
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     RCOM_1052220
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     RCOM_1052220
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     RCOM_1052220
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 724 aa AA seqDB search
MAKPHVTMEVGNDGVAVISMSNPPVNALAVPIIMGLKEKFTEAARRKDVQAIVLTGKNGR
FSGGFDISVMQKVHQTGDASILPDVSVDLVVNAIEDCKKPVVAAVEGLALGGGLELAMGC
HARIVAPKTQLGLPELSLGIIPGFGGTQRLPRLVGLPKAIQMMLTSKPIMSEEGKKLGLV
DVIVSSQELLKVSRQWALDIKERRKPWMRSLHMTDKLGSLSEALELLKAARQQAKKTAPN
MPQHQACLDVIEDGVVHGGYSGVLKEAKVFKELVISDTAKSLIHVFFAQRTTSKVPNVSD
IGLKPRQIKKVAVIGGGLMGSGIITALITSGIYVVLKEINSEYLLKGIKMVEANVRGLVT
RGKLSPDKADKALSMLKGVLDYSDFRDVDMVIEAVIESIPLKQKIFSEIEKACPPHCILA
TNTSTIDLNLVGKKTSAQDCIIGAHFFSPAHIMPLLEIVRTDKTSPQAILDLMTVGKSIK
KVSVVVGNCTGFAVNRTFFPYAQGAHLLVNLGVDVFRIDRVICNFGLPMGPLQLQDLAGY
GVAVAVGKEFATAFPDRTFKSPLVDLLIKSGRNGKNNGKGYYIYEKGSKPKPDPSVIPII
QESQRLTNIMPNGKPISISDQEIVEMIFFPIVNEACRVLEEGVVVRASDLDIASVLGMSF
PSYRGGIVFWADTVGPKHIYTSLKKWSLLYGNFYKPSRFLEERALKGMPLSAPVSSSPGS
RSRM
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagcctcatgtgaccatggaagttggaaacgatggcgttgctgtcatttccatg
tctaatcctcctgttaacgccttagccgttccaattattatgggtttgaaggagaagttc
actgaggctgcaagaagaaaagacgttcaagctattgttttgactggcaagaatgggagg
ttttcaggtggttttgatatcagtgtaatgcaaaaggttcaccagactggggatgcttca
attttgcctgatgtttctgttgatctcgtggtcaatgcaattgaagattgcaagaagcct
gttgttgctgctgtagaaggattagcacttggaggtggcttagaactagcaatgggatgc
catgctcgtattgttgcacctaaaactcaacttggcttgcctgagttgagtcttggaata
attcctgggtttggaggtacacagcgtcttccaaggcttgtaggactgccaaaggccatt
cagatgatgctgacatccaaaccaatcatgtctgaagaagggaagaagctaggtcttgtt
gatgttattgtgtcttctcaagaactgctgaaagtatctaggcaatgggctttagacatc
aaagaaaggcgcaaaccatggatgcgttctcttcatatgacagacaagcttggttccctg
tctgaagcacttgaattactgaaagctgccagacaacaggccaagaagactgctccaaat
atgcctcagcatcaggcatgtcttgatgtgattgaggatggtgttgttcatggaggatat
agtggagttctaaaggaagcaaaagtattcaaggagttagtaatatcagacacagcaaaa
agtcttattcatgtcttttttgcccagcgcacaacatcaaaggtgcctaatgtctctgat
attgggctcaaaccaaggcaaataaagaaggttgctgtcattggtggaggtttaatgggt
tctggcataattacggctcttatcacgagcggcatttatgttgttctcaaggaaattaac
tctgaatatcttctgaaaggaataaagatggtagaagcaaatgtccgagggttagtaact
aggggaaagctgtcaccagataaggcagacaaagccctctcgatgcttaaaggtgtgctg
gactactcagatttcagagatgtggatatggtcatagaggcagttattgaaagtatccct
ctgaagcaaaaaatttttagtgaaatagagaaggcttgtcctcctcactgcatcttggct
acaaatacatctactattgacctcaatttagttggaaagaagaccagtgctcaggattgc
attataggtgcacactttttcagtcctgctcatataatgcctctactggagattgtacgt
acagacaagacttctccacaagcaatccttgatctcatgacagttgggaaatctataaag
aaagtttctgttgtggtgggtaactgcactggctttgcagtcaatcgtactttctttccc
tatgcacagggtgcgcatcttctggtcaatctaggtgtggatgtattcagaattgataga
gtgatctgcaattttggcctccctatgggccctctacagcttcaggatttagctggatat
ggagttgctgttgcagtgggaaaagaatttgctactgcattccctgatcgcacattcaag
tctccattagttgatctcttaattaaaagtggacgaaatggtaaaaacaatggaaaagga
tactacatttatgagaagggaagcaagccaaaacctgatccttctgtgataccaattata
caggagtctcagcggcttaccaatattatgcctaatggaaagccaataagcatttctgac
caagagattgtggagatgattttctttccaatagtgaatgaagcatgccgagttcttgaa
gagggagtggtagttcgagcatcagatctggatatcgcatctgttctgggaatgagtttc
ccatcttatcgtggtggtattgttttctgggctgacacggttggacctaagcatatatat
acgagtctgaagaagtggtctctgttatatggtaacttctacaaaccatcaaggttcttg
gaagaaagggcattaaaaggcatgccattgagtgccccagtttcatcatctcccgggtca
agatcccgcatgtag

DBGET integrated database retrieval system