KEGG   Ricinus communis (castor bean): RCOM_1062770Help
Entry
RCOM_1062770      CDS       T01087                                 

Definition
diphosphonucleoside phosphohydrolase, putative (EC:3.1.3.57)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:rcu00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 392 aa AA seqDB search
MEDPKSFGLPYQESEKYSKELDIAVRAVQMACSLCQKVQDSLISKTSAHVQAKDDNSPVT
IADWSVQATVSWILSQSFGSRNISIIAEEDVQSLSKADSAGLLEAVARTVNECLAEAPRF
GVKAPGKFLSNSEVLEAISRCNSTGGPTERFWAVDPVDGTLGFVRGDQYAVALALIEDGE
VVLGVLGCPNYPMKKEWLNYHHRYHRIISKLTPPTSESWDKGCVIYARKGSGKAWMQPIL
QGHKKLVWPNSARPVQVSSIDNPALATFCEPVEKANSSHSFTAGLAHSVGLRMQPLRMYS
MVKYAAIARGDAEIFMKFARAGYKEKIWDHAAGVVIIQEAGGVVTDAGGRPLDFSKGIYL
EGLDRGIIASAGAKLHDTIIKAVDASWNSSSL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaggacccaaaaagttttggtcttccttatcaagaatcagaaaaatactctaaagaa
ttggatattgctgtcagagctgttcagatggcatgttctctttgccagaaagtgcaggac
agtttgatttccaaaaccagcgctcacgtccaagccaaggatgataattctcctgtcacc
attgctgattggagtgtccaagccactgtcagctggatactatcccagtccttcggaagt
aggaacatatcaattattgctgaggaagatgttcaatctttgtccaaggccgattcagct
ggcctattagaagctgtagctcgaactgtaaatgaatgtttggctgaagcaccccgcttt
ggcgttaaggctcctggaaagtttctcagcaattcagaggttcttgaagccatcagtcgt
tgcaactcaactgggggtcctactgaacgattttgggctgtcgatcctgttgatggcaca
ttgggttttgtacgtggagatcaatatgctgtcgctttagcattaatagaggatggagag
gtcgtgcttggagttcttggttgcccaaattatccaatgaaaaaagaatggttaaattat
caccatcgctaccatagaattatatccaagttaaccccaccaacatctgaatcttgggac
aaaggctgtgtaatttatgcaaggaaaggtagtggaaaggcttggatgcaacctatactc
caaggacataagaagcttgtgtggccaaactctgcaaggccagttcaagtatcctccatt
gacaatccggcattagctaccttttgtgaaccagttgagaaagcaaattcaagccactcc
ttcacagcaggactagctcacagtgttgggcttaggatgcaaccgttacgcatgtacagc
atggtgaagtatgctgccatagctcgaggagatgctgagatttttatgaagtttgcaagg
gctggctacaaggaaaagatctgggatcatgcagcaggtgttgttatcatacaagaggct
ggtggtgtggttactgatgcaggagggcgtcccctggacttctcaaagggcatctactta
gaaggtcttgatcgaggcataattgctagtgctggcgccaaattgcatgacacgattatt
aaggctgttgatgctagctggaactcctctagtctgtaa

DBGET integrated database retrieval system