KEGG   Ricinus communis (castor bean): RCOM_1076600Help
Entry
RCOM_1076600      CDS       T01087                                 

Definition
beta-hexosaminidase, putative (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:rcu00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:rcu00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:rcu00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:rcu00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:rcu00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 527 aa AA seqDB search
MGLQMHFQLAVMLLMLLVGNGHGSSDFNIWPMPNSVSNGYRRLYMAPHFQLLTDWDDASG
ILNDAFSRMLHVVQMDHALKNANFSASHPSLILKGLHILILSPNLQQLQYGVDESYKLLV
PAPEKPEYALLEAQTIYGALHGLQTFSQLCHFNFKTSVIEVRMVPWTIIDQPRFSYRGLL
IDTSRHYQPLPMIKKVIDSMAYAKLNVLHWHIVDTQSFPLEIPSYPKLWNGAYSVSERYT
FADAAEIVSYAERQGIHILAEIDVPGHALSWGKGYPSLWPSKDCQQPLDVSNEFTFKVID
GILSDFSKIFKFKFVHLGGDEVDTSCWTSTPHIMNWLKKHNRNESEAYQYFVLRAQQIAL
SHGYEIVNWEETFNSFGNKLSRKTVVHNWLGGGVAQQVVASGLRCIVSNQDQWYLDHLDT
TWQEFYMNEPLTNITNIEQQKLVIGGEVCMWGETVDASNIEQTIWPRAAAAAERLWTSYD
KLAKNPREVTGRLAHFRCLLNQRGVAAAPVAGPGRGAPLEPGSCYLQ
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgggcctgcaaatgcatttccaactagcagtaatgttactaatgttgttggttggcaat
gggcatgggagtagcgactttaatatatggccaatgccgaactcagtgagcaacggctac
aggaggctttacatggcccctcattttcagttgctcactgactgggatgatgcttctggg
attttgaacgatgccttctccagaatgcttcatgttgtccaaatggaccatgctcttaaa
aatgccaacttctccgcttcccatccttctctcatcctcaaaggacttcatattctcatt
ctctctcccaatcttcagcagttacaatatggtgttgatgaatcgtacaaattactagtc
cctgcacctgaaaagccggaatatgcacttcttgaggcgcagacaatctatggagcttta
catgggcttcagacattcagccaactatgccattttaactttaaaaccagtgtgattgaa
gttcgaatggtcccatggacaatcattgatcagccaaggttctcttaccgggggctcttg
attgatacttcacgacattatcagccactgccaatgattaagaaagtgattgattctatg
gcctatgcaaaactgaatgttttgcactggcacattgtagatacacaatcttttcctctg
gagataccttcatatccaaaactgtggaatggtgcttattcagtttccgagcgatacact
tttgctgatgctgcagaaattgtgagttatgccgagaggcaaggaattcatatattggct
gaaattgatgttcctggacatgcactctcatggggaaagggctatccttctttatggcca
tcaaaggattgtcagcaaccacttgatgtcagcaatgagtttacatttaaagtgatagat
ggaatcctttcagatttcagtaagatctttaaatttaaatttgttcacttgggaggtgat
gaagtcgacacaagttgttggacatcaactcctcacataatgaactggttaaaaaagcat
aataggaatgaatctgaagcttatcagtactttgtcctgcgggcacagcaaatagctttg
tcccacggatatgaaattgttaactgggaagaaaccttcaatagttttggaaataaattg
agccggaaaaccgtggtgcacaactggcttggtggtggtgttgctcagcaagttgttgct
tctgggttgaggtgcattgtgagcaaccaggaccaatggtatttagatcacttggatact
acatggcaagaattctatatgaatgaaccactcacaaacatcactaacatcgagcaacag
aagttggttattgggggtgaagtatgcatgtggggagaaacagttgatgcatccaacatt
gaacaaaccatatggccacgtgctgcggcagctgcagagcgactatggacatcttatgac
aagcttgccaagaatccaagggaagttactggaagattggcacacttcaggtgtctgttg
aatcaaagaggagtggcagcagctccagttgctggacctggccgaggagcccctctagaa
ccaggttcttgctatttgcagtaa

DBGET integrated database retrieval system