KEGG   Ricinus communis (castor bean): RCOM_1095760Help
Entry
RCOM_1095760      CDS       T01087                                 

Definition
Sphingosine kinase, putative (EC:2.7.1.138)
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    RCOM_1095760
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     RCOM_1095760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 479 aa AA seqDB search
MDSSPQPIISDQVIVNGATTLLTLTAGGILRWTDRGQRCLTVEKEVLGFVIEGSKIRVKT
IIDNGDGICCAGNSGALVRKDFVFQPLTEDSQRVLCNRLRDYLDSLGRPKRLLVFVNPFG
GKRSASKIFFDTVKPLLEDADVQITLQETKHQLHAKEVTSTLDISKYDGIVCVSGDGILV
EVVNGLLAREDWRDAIKLPLGMVPAGTSNGMAKSLLDSVGEPCKASNAVLAIIRGHKCSL
DVATILQGETKFFSVLMLSWGLVADIDIESEKYRWMGSARIDFYAVQRIFHLRHYNGCIS
FVPAPGFETYGVPTSYNAESTSKQEQPLKTQHGYQGPDVNLVNLDWRMISGPFVSIWLHN
VPWGGEDVMAAPDAKFSDGYLDLILIQQCPKLSLLALMTALNNGDHVKSPYVIYLKVKAF
ILEPGPRTDDPTKGGIIDVDGEVLARGNGSYKCDQKSLMVYDKLHMMVDQGLATLFSPV
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggactcgtcgccacagccaataatctcggaccaagtgatcgtcaacggcgcaacgact
ctgttaactttgaccgcaggtggaattctccggtggacggatcgaggtcaaaggtgtttg
accgtcgaaaaagaagttcttggatttgtaatcgaaggaagtaagataagagtgaaaact
attatcgataacggagatggaatctgctgtgcaggtaatagtggagctcttgtgaggaaa
gatttcgtgtttcagcctctaactgaagactcgcagcgagttttgtgtaatcgtctccgt
gattacctcgattctctaggtcgtccaaagagattgcttgtatttgtgaatccatttgga
gggaagagatctgcatcaaagatattttttgatactgtcaaacctttacttgaagatgct
gatgttcagattacattgcaagaaactaaacatcagcttcatgcaaaggaggtcactagc
actctggatatttctaaatacgacggtattgtttgtgttagtggagatggtattcttgtg
gaggtggtaaatggacttttagcaagagaggactggagagatgcaataaagctgcctctt
ggaatggttcctgcaggtacaagcaacggtatggcaaaatctcttctggattctgttggt
gaaccctgtaaagcatctaatgccgttttagcaataatacgaggtcataagtgctcactg
gatgttgctactatcctgcaaggagaaacaaaatttttcagtgtcttgatgctttcatgg
ggtctagtagcagatattgacattgagtctgaaaagtaccggtggatgggaagtgctcgt
attgacttttatgctgttcaacgaatattccacttaaggcattataatgggtgcatttct
tttgtgcctgcacctggctttgaaacttatggggtgccaaccagttataatgctgaatct
actagcaaacaagagcagcctcttaagactcaacatggttatcagggacctgatgttaac
ttagtcaatctggattggaggatgatcagtggaccatttgtttcaatatggcttcataat
gtaccttggggtggggaggatgtcatggctgcacctgatgcaaagttctcagatggttat
ttggacctgatactcatccagcaatgcccgaaattgtccttgctagcattgatgacagcg
ttgaataacggagatcatgtcaaatcaccgtatgttatataccttaaggtgaaagcattc
atattggagcctggtccacgcactgatgatccgaccaagggagggatcatagacgtagat
ggtgaggtccttgccagaggaaacggatcatacaaatgcgaccagaagagtctgatggtc
tacgacaagcttcacatgatggtcgatcaaggtttagctactctcttttcacctgtataa

DBGET integrated database retrieval system