KEGG   Ricinus communis (castor bean): RCOM_1197790Help
Entry
RCOM_1197790      CDS       T01087                                 

Definition
amsh, putative
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:rcu04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 514 aa AA seqDB search
MRSSSAPGRINIATSAQKIDVDNRISLRFYYRIADNILKQADIFREEKNIIDLYIMLLRF
SSLVSETIPCHRDYRTSQQSKKIYLKQKLLNAVKELEQLKPAVQQKINELNRKHTHQVNG
WGSVNQNDSLEWPPVKKKTLTGYDAGATKAVIPAAREFVYHGSRTQQLSYARPVGEQFRK
MSLNFPQPKEETLSRHSILGPNGLQGQWQPPKSDKGVWYPSNIDLSPVEIPRFDSSLENG
LALKLDSSSSELETLSSQSVLTVNDNSQTSRVEELSPMISFETTETPVQTDLIRQPSPPA
VLAEVQDLIPAMSPQATEAENKMDISSPDDIVRSESPLQLHISTTMMENFMKLAKANTDR
NLETCGVLAGSLKNRKFYVTALIIPKQESTSDSCQTTNEEEIFEVQDKRSLFPLGWIHTH
PTQSCFMSSIDVHTHYSYQIMLPESVAIVMAPRDTSRTHGIFRLTTPGGMSVIRNCQQRG
FHPHDQPPDGGPIYKTCTDVYMNPNLKFDVIDLR
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgtcttctgctcccggtagaataaatatcgctaccagtgctcaaaagatcgat
gttgataatcggatttctctccggttttactaccgaatcgctgataatattctaaagcag
gcggacatctttcgagaagagaaaaatattatagacctttatattatgcttttgaggttt
tcaagcttggtatcagaaacgataccatgccatcgagactataggacatcccaacaaagc
aagaaaatatatttgaaacagaaattgttgaatgctgtgaaggagttggagcagttgaag
ccagcagtgcagcaaaagatcaatgaattgaatagaaaacatacacatcaagtaaatggg
tggggctctgtgaatcaaaatgattcgttagagtggcctcctgtcaaaaagaaaaccttg
actggttatgatgctggtgcaacaaaggcagtgataccagctgcacgagaatttgtctat
catggttcaagaactcagcaattatcatatgctaggccagtgggggagcagttccggaaa
atgtctttaaactttccacaaccaaaggaggagactctgtccagacattctatactgggt
ccaaatgggcttcaggggcaatggcaaccacctaagagtgataaaggagtctggtatcct
agcaacatagacctcagtccggttgaaatccctaggttcgactcttctctagaaaatgga
ctcgcactaaaattagatagtagcagctcagaactcgaaacattaagttcacaatcagtt
ctcactgtgaatgataatagtcagacgagccgtgttgaagaactgagtccgatgatttct
tttgaaacaacagaaacccctgttcagacagatctgattagacagccttctcctccagct
gtgcttgcagaagtacaagacttaatacctgcaatgtctccccaagctactgaagcagaa
aataaaatggacatttcttcacctgatgatattgtccgttctgaatctcccctgcaactg
cacatttcgaccacaatgatggagaatttcatgaagctggcaaaggccaatactgatagg
aatttagaaacttgtggtgtcctagctggttcactgaaaaacagaaagttctatgttaca
gctcttatcatcccaaagcaggagtccacatcagattcatgtcagaccacaaatgaagag
gaaatatttgaagtgcaggataagcgatctttattcccccttgggtggatacatacgcat
cctacacagtcttgtttcatgtcttcaattgatgttcacacccattattcgtatcagatt
atgttgccagaatccgttgccattgtcatggcgccaagagatacttcaagaacccatggc
atttttcggttgacaacccctggtggcatgtcagttataagaaactgccagcaacgtgga
tttcatccgcatgatcaacctccagatggtgggcccatctacaagacctgtacagatgtc
tatatgaatcccaacctaaagtttgatgtcattgaccttcggtga

DBGET integrated database retrieval system