KEGG   Ricinus communis (castor bean): RCOM_1217850Help
Entry
RCOM_1217850      CDS       T01087                                 

Definition
eukaryotic translation initiation factor 4e, putative
Orthology
K03259  
translation initiation factor 4E
Organism
rcu  Ricinus communis (castor bean)
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:rcu03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 201 aa AA seqDB search
MATETAIEGTTATEIGTENPAPAQQHKLERKWTFWFDNQSKPKQGAAWGTSLRKVYTFDT
VEEFWCLYDQIFKPSKLPASADFHLFKAGVEPKWEDPECANGGKWSVTCGRKALLDTMWL
ETLMALIGEQFDDSDEICGVVASVRPRGDKLALWTRTATNEAAQMGVGKKWKEIIDVTDK
ITYSFHDDSRRERSVKSRYNV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgaaacagcaattgaaggaaccaccgccacagagatcggaactgagaatccg
gcgccggcgcagcagcacaagctagagaggaagtggacgttttggttcgataaccaatca
aagcccaaacaaggcgccgcctggggtacttctcttcgtaaagtgtacaccttcgatacc
gttgaagaattttggtgtttgtatgatcagatattcaagccgagtaagctacctgcaagt
gctgattttcatttatttaaagctggagttgagcctaaatgggaagatcccgagtgcgct
aatggaggcaaatggtctgttacttgtggcaggaaggctcttcttgatactatgtggctt
gagactttgatggctttgattggggaacaatttgacgactccgatgagatatgtggtgtg
gttgcaagtgttcgcccaaggggggataaactcgcattatggacaaggacagcaacaaat
gaggctgcccagatgggcgtcggcaagaagtggaaggagatcattgatgtcactgataag
atcacttacagcttccatgatgattctaggagggaaagatctgtgaaaagccgatacaat
gtatga

DBGET integrated database retrieval system