KEGG   Ricinus communis (castor bean): RCOM_1220860Help
Entry
RCOM_1220860      CDS       T01087                                 

Definition
Eukaryotic translation initiation factor 3 subunit, putative
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
rcu  Ricinus communis (castor bean)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    RCOM_1220860
Translation factors [BR:rcu03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    RCOM_1220860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 222 aa AA seqDB search
MEDWEDEQIPPLILKEQPKSKWDDEDVDDNDVKESWEDEDEPAPEPVAKPPPEKATKKPV
TKSIEKKGKTVVAKEESQPLDPVAEKLRQQRLVEEADYRSTTELFGKRGDEKTLDNFIPK
SESDFLEYAELVSHKLRPYEKSFHYIGLLKAVMRLSMTAMKAADAKDVASSVTAIANEKL
KAEKEANAGKKKGGKKKQLHVDKPDEDLVVDSYDALDDYDFM
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggaggattgggaggacgaacaaattccacctctcattttaaaggagcagcctaaaagt
aaatgggatgatgaagatgtggatgacaatgacgtgaaggaatcatgggaggatgaagat
gaaccagctccggaacctgtagcaaaaccccctccagaaaaggccactaagaaacctgtg
acaaagtctatagaaaagaaaggcaaaactgttgtagcgaaagaagagtcccaaccacta
gatcctgttgctgagaaacttcgccaacaaaggctagtggaagaagctgattacaggtct
actacagaactctttgggaagagaggagatgagaagacacttgataattttattcccaaa
tctgagagtgacttcttggaatatgcagaacttgtttctcataagcttcgtccatatgag
aaaagctttcactatattggattacttaaggcagtaatgagactgtcaatgactgctatg
aaagcagcagatgcaaaagatgttgcatcttctgtaactgctattgcaaatgaaaagctg
aaagcggaaaaagaagccaatgctggtaaaaagaaaggtggaaagaaaaaacagctccat
gtggacaagcctgacgaggatttggtggttgatagctatgatgcgcttgatgattatgac
ttcatgtga

DBGET integrated database retrieval system