KEGG   Ricinus communis (castor bean): RCOM_1256040Help
Entry
RCOM_1256040      CDS       T01087                                 

Definition
Ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 791 aa AA seqDB search
MELLRSNLSRVRIPEPTNRIFKHECCISFDTPRSEGGLFIDMNTFLAFGKDCVGWNYEKT
GNPVYLHIKQTAKLIPEDRPSKKPTLLAIGIEGGFDNNEPDYEETHSIVILPDYVTFEFP
SVELPEKVRLAADAILMAEGAERKEQLAAWTADKKQISSYAMNLQQIDNGVIVPPSGWKC
SKCDKKENLWLNLTDGMILCGRKNWDGSGGNNHAIEHYKETGYPLAIKLGTITADLEAAD
VFSYPEDDSVLDPLLAQHLAFFGIDFSSLQKTEMTTAERELDQNFNFDWNRIQESGQELE
PIFGPGYTGLRNLGNSCYMAATMQVVFSTRSFSSRYYANQSLKTAFQMAPADPTLDLNMQ
LAKLGHGLLSGRYSIPALEKQEGIPPRMFKAVIAASHPEFSSMRQQDALEFFLHFLDQVE
RANGGKTTLDPSRSFKFGIEERILCSSGMVAYNKRLDYILSLNIPLHEATNKEELAAFQK
LKAEGVSKGKDVSSEEIVRPRVPLEACLASFSAPEEIQDFYSTALNAKTTAEKTAGLTSF
PEYLVLHMRKFVMEEGWVPKKLDVYIDVPDVIDISHMRSRGLQPGEQLLPEGVSGGEVEA
NKIVANEDIVFQLRSMGFNHLYCQKAAINTFNTGVEEAMNWLLSHMDDPDIDAPISQEGT
EIVDQSKIDTLISFGFQEEIARKALKASDGDIEKATDWIFNNPDASASSDMDATTPSTTS
TADDTVLPDGGGRYKLFGIVSHMGTSTQCGHYVAHILKGGKWVIFNDDKVGVSVNPPKDM
GYLYFFERLDD
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctccgatccaatttatctcgtgttcggattccagaacccaccaatcgcatc
tttaaacatgaatgctgcatctctttcgacactcctagatctgaaggtgggctgtttatt
gacatgaacacatttcttgcatttgggaaggactgcgttggctggaactatgagaagact
ggaaaccctgtttatttgcacataaaacaaacggcaaagctgattcctgaagatagacct
tcaaaaaagccgactttattggctataggtattgaagggggatttgacaacaatgaacct
gactatgaagaaactcacagtatagtaatattgcctgattatgttacttttgaatttcct
tctgttgagttgccagagaaggtaagattggcagctgatgccatcttaatggctgaaggt
gcagaacggaaggaacagcttgctgcttggacagctgataagaagcaaattagttcatat
gcaatgaatttacaacagattgacaatggtgttattgttcctccatctgggtggaaatgt
tcgaagtgcgataaaaaagagaatctgtggttgaatcttactgatggaatgatcctttgt
ggacggaaaaattgggatggaagtggcggcaacaaccatgctattgaacactataaggag
acaggttaccctcttgctataaagcttgggacaattactgctgatctggaagcagcagat
gtattttcttatccagaggatgatagtgttttggacccacttttagcacaacatctggca
ttttttggtattgatttttcatcgttacagaagactgaaatgacaactgctgaaagagaa
cttgaccagaatttcaactttgattggaaccgaattcaagaaagtggacaggaattggaa
ccaatttttggaccaggttacacaggacttcggaatcttggcaacagttgctacatggca
gcaacaatgcaagttgtattctcaacaagatccttttcttcacgatactatgccaatcag
agcttaaaaacagcatttcagatggctcctgctgatccaactttagacttgaatatgcag
ttagcaaaactgggacatggtttgctatctggtagatattcaattccagcattggagaag
caggaaggtataccccctcggatgttcaaagcagtaattgctgccagccatcctgaattt
tcttctatgaggcaacaggatgcactggaattcttcctacatttccttgaccaagttgaa
cgtgctaatggtgggaagactacattggatccttcaaggagtttcaaatttggtattgag
gagcgtatcttgtgttcatctggaatggtagcttataataaaaggctcgactatattctt
tctttgaatattccactacatgaagctactaacaaagaagaacttgcagccttccaaaaa
ctgaaagcagaaggggtttcaaaagggaaagatgtatcaagtgaagaaattgtacgccca
cgagtacctctagaggcatgtctagctagcttttcagctccggaggagatacaggatttt
tacagcactgctttgaatgctaagacaacggctgagaagactgctggtttaacttcattc
cctgaatatctggtattacacatgcggaaatttgttatggaggaaggatgggtgcctaaa
aagcttgatgtctatatagatgttcctgatgtcatagatatcagtcacatgcgaagcagg
ggccttcaaccaggggagcagttgttgccagagggtgtttctgggggtgaggtggaagca
aataagattgtggctaatgaggatattgtcttccagcttcgctcgatggggttcaaccat
ctttattgtcagaaagctgctataaatacctttaacactggagtagaagaggcaatgaat
tggttactttctcacatggatgatccagacatagatgctcctatttctcaagaggggact
gagatcgttgatcaatccaaaattgatactttgatctcattcggatttcaagaggagatt
gctcgaaaagcactcaaggcgtcggatggtgacattgagaaagcaacagattggatattc
aacaatcctgatgcttctgcttcatctgatatggatgccactactccaagcaccacgtct
accgcagatgataccgtacttcctgatggaggagggagatacaagcttttcggaatagtg
agtcatatgggaacctctactcagtgtggtcattatgttgctcatatccttaaaggtggg
aaatgggtaattttcaatgatgataaggttggggtttctgtaaacccgccgaaggacatg
ggatatttgtatttttttgagaggcttgacgactag

DBGET integrated database retrieval system