KEGG   Ricinus communis (castor bean): RCOM_1282040Help
Entry
RCOM_1282040      CDS       T01087                                 

Definition
expressed protein, putative
Orthology
K12655  
OTU domain-containing protein 5 [EC:3.1.2.15]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MTRILVQRGSGSSSSNQSRAGSSSAARSEIQGAATPQVISALKDDEIVDEAQQLHVVDEL
LEYCGSSEIKAAKNDELPMEGLNSDKNESSSSEVVDNEKLVNAEGVRSGELVKGLDRLRV
TERPTPESDGSSSGSPDVGSGSPQPPPPPVPPPKPLATNSSSRRSVSGISNAVRTGSSRR
AVAWPVVSTRTSPSGSRPSSPRSHGDSEGYNSADEQNPCFGSSYDDLERERQFEIDIRRS
KGLEVKRMLEDGNCLFRAVADQVYGDSEVYDLTRQMCIDYMERERDHFSQFITEGFTSYC
KRKRRDKVYGNNVEIQALSEMYNRPIHIYSYTTEPINIFHGSYNTDTPPIRLSYHHGNHY
NSLVDPRRLTVGAGLGFSCLRGTNVDKDQVKAAIKAQQDQQIDNALLAEGRFYSDLELTE
KEIERMVMEASRAEYLANDKFKQQLCHKESSTSGAEPSSSGARSSDSETKVEGTRTNSLQ
DTVLSSSMQMVLSMGFSYLQAIEAYSIFGDDVDSMVCYLLETASSSRRKGKATE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgactcggattttggttcaacgaggcagtggttcttcttcttcaaaccagagccgggca
gggtcctcttcagctgctcggtcagagattcaaggtgcagctacccctcaggtcatttca
gctctgaaagatgatgaaattgttgatgaggcacagcaacttcatgttgtggatgagctc
ttggagtattgtgggagtagcgagatcaaggctgcaaaaaatgatgagctaccgatggaa
ggcttaaatagtgataaaaatgagagttcgagtagcgaagttgttgataacgagaaactg
gtcaatgctgagggtgtcagatcaggggaattggtaaaaggattggatcggctgagggta
acggagagacctacacctgagagtgatggttcaagcagtggttccccagatgttggcagt
ggaagcccgcaaccaccaccccctcccgtgccacctccaaaacctttggcaacaaactca
agctcaaggagatctgtatcaggaatttctaatgctgtgcgaactggatcatctagaaga
gcagttgcttggcctgttgtttccacaagaacttcaccatctggatcacggccttcctcc
cctaggtctcatggcgacagtgaggggtataatagtgctgatgagcagaacccttgcttt
ggttcctcctatgatgatctggaaagagagcgccaatttgagattgacataaggcggtct
aaaggactagaagtcaaaagaatgctagaggatgggaattgtctcttccgtgctgttgct
gatcaagtatatggagattctgaagtatatgatctgactagacaaatgtgcatagactat
atggaacgggagagggatcacttttctcaatttataacagaaggctttacatcttactgt
aagagaaagagaagagacaaggtttatgggaacaatgtggagattcaagctttatcagaa
atgtataaccgacctatccatatttactcatataccacagagcctatcaacattttccat
ggaagctacaacactgatacgccacccataaggctaagttaccatcacggaaatcactat
aattctcttgttgacccacgtcgactgacagttggtgcaggacttggtttcagctgtctt
cgagggacaaatgtggacaaggatcaggtgaaagctgcaattaaagctcaacaagaccag
cagattgacaatgcacttttagctgaggggcgattttactcagatcttgagcttactgag
aaagagattgaaagaatggtgatggaagcttctcgtgcagagtatctggccaatgataag
ttcaaacagcaactttgtcacaaagaatcttctacatctggtgctgaaccatcttcttct
ggagcaagatcatcagacagcgagactaaggtggaaggcacgaggacaaacagtttgcag
gatactgtacttagcagtagcatgcagatggttctgtcaatgggattcagctatctgcaa
gcgattgaggcatacagcatatttggtgacgatgtggattcaatggtctgttacctcttg
gaaactgccagtagcagcagacgaaaaggcaaagcgactgaatga

DBGET integrated database retrieval system