KEGG   Ricinus communis (castor bean): RCOM_1298200Help
Entry
RCOM_1298200      CDS       T01087                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5, putative (EC:3.4.19.12)
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MSWCTIESDPGVFTELIQHMHVKGVQVEELYSLDLDSLDSLRPIYGLIFLFKWHPGEKDE
RPVMKDPNPNLFFASQVINNACATQAILSILMNCPDIEIGDELTKLKEFTKNFPPELKGL
AINNSEVIRTAHNSFARPEPFVPEEQKAAGKDDDVYHFISYLPVDGVLYELDGLKEGPIS
LGPYTGGPNDLDWLRMVQPVIQERIERYSNNEIRFNLMAVIKNRREVYTAELKELQRRRE
RILQQLAASQSDRLVDSSTSEQLSKSLSEVNSGIEAATEKILMEEEKFKKWRTENVRRKH
NYIPFLFNFLKILAEKKQLKPLIEKAKQKTGMSEG
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtgcactattgagtctgatcctggtgtatttactgaacttatacaacatatg
cacgtgaaaggtgttcaggttgaggagctatactccttggatcttgattctctagacagc
cttaggcctatatatgggttgattttccttttcaaatggcacccaggggaaaaagatgaa
cgtcctgtgatgaaggatccaaaccccaatcttttctttgctagtcaggtcattaacaac
gcttgtgcaacccaggcaattctatccatcctaatgaattgcccagatattgaaattggt
gatgaactgacaaaattgaaagaattcactaagaattttccacctgagctcaaaggtttg
gctattaacaacagcgaagtcatacgtacggctcataacagttttgccagacctgagcct
tttgttcctgaggagcagaaggctgctggaaaggatgatgatgtgtatcattttataagt
tatttgcctgttgatggagtgctttatgagcttgatggcctgaaagaaggtcccattagc
cttggcccgtacactggtgggcccaatgatctggactggttgcgaatggtgcagccagtg
atccaagagcgtatagagaggtattccaataatgaaataagattcaatctcatggcagta
atcaagaacaggagagaggtatatactgcagaactcaaggagctccagaggaggagggaa
cgaatcttgcagcagctggctgcatcccaatctgaccgactggtggacagtagtacatca
gagcaattgagcaaatctctgtcagaggtaaattctgggattgaggccgcaactgaaaag
atattgatggaggaggaaaagttcaaaaagtggaggacagaaaatgttcgtagaaagcac
aattacataccctttttgttcaacttcctgaagattcttgctgaaaagaagcagctgaag
cctcttattgagaaggccaagcaaaagacgggaatgtctgagggatag

DBGET integrated database retrieval system