KEGG   Ricinus communis (castor bean): RCOM_1303600Help
Entry
RCOM_1303600      CDS       T01087                                 

Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase, putative (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_1303600
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RCOM_1303600
  Amino acid metabolism
   00310 Lysine degradation
    RCOM_1303600
Enzymes [BR:rcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     RCOM_1303600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MMLGVLRRRVTTGASSSSVLRRSLQTTKPAASAPRVSSLPEKEILLNLRGLGSAGNFSTF
ISSGCSVSSRSIRDASSMMATKQVWIRPFSSDSGDLVDAVVPFMGESITDGTLAKFLKNP
GDRVEVDEPIAQIETDKVTIDVASPEAGVIKEFVAKEGETVEPGTKVAIISKSGEGVAHV
APSEKVPEKVSPKASAPEKTEEKQKPKVDTAPVTEKPKTPAPPPPKRSATEPQLPPKERE
RRVPMTRLRKRVATRLKDSQNTFAMLTTFNEVDMTNLMKLRSEYKDAFVEKHGVKLGLMS
GFIKAAVSGLQNQPIINAVIDGDDIIYRDYIDISIAVGTPKGLVVPVIRNADKMNFAEIE
KEINTLAKKANDGTISIDEMAGGSFTISNGGVYGSLLSTPIINPPQSAILGMHSIVSRPM
VVGGNVVPRPMMYIALTYDHRLIDGREAVFFLRRIKDVVEDPRRLLLDI
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgatgttaggagttttaaggagacgagttactactggagcttcctcttcttcggttttg
aggcggtccctgcagactactaaacctgctgcttctgcacctagagtttcttctcttcct
gagaaggagattttacttaatttaagaggtttagggagtgctggaaacttcagcaccttc
atttcatcaggttgctcggttagttcaaggtccataagggatgcttccagcatgatggct
accaagcaagtgtggattaggccattttcttcggatagtggggatttggttgatgctgtt
gtcccttttatgggtgaatccataacagatggaactttggcaaaattccttaagaatcct
ggtgatagagtagaagttgatgagccaattgctcaaattgagacagataaggtgacaatt
gatgtggccagtcctgaagcaggtgtaattaaagagtttgtggccaaggaaggggagact
gtggaacctggtaccaaagttgctattatttcaaagtctggcgaaggtgtagctcatgtt
gctccctctgaaaaagtcccagagaaagtctctcctaaggcatctgctccagaaaagact
gaagagaagcaaaagcctaaagttgatactgctcctgtaactgagaagcctaaaacacca
gcaccaccacctcctaaacgctcagcaacagaaccccagctccctcctaaggaaagggaa
agaagagttccaatgacaaggctccgaaaaagagtagcaacccgattgaaggactcccag
aacacttttgctatgctaacaacattcaatgaagttgatatgactaacttgatgaagctc
cgatctgagtataaggatgcttttgttgaaaaacatggagttaagttgggccttatgtca
ggatttataaaggctgccgtaagtggactccagaatcaacctattataaatgcagttata
gatggggatgatatcatttatagagattatatagacatcagtattgctgttggcactcca
aagggccttgtcgttcctgttattcgcaatgctgataaaatgaattttgctgagattgag
aaggagatcaacacccttgcaaagaaggctaatgatgggactatatcaattgatgagatg
gctggaggttcatttacaatatctaatggaggagtttatggaagcctcttgagtacacct
atcattaaccctcctcagtcggctattttgggcatgcactcaatagtgtcccgtccaatg
gttgttggaggcaatgtcgtcccaaggccaatgatgtatattgctctgacatatgatcat
aggctgatcgatggaagagaggccgttttctttttgcgtcgtatcaaagatgtggtggag
gatccacgcaggctgctgcttgacatttga

DBGET integrated database retrieval system