KEGG   Ricinus communis (castor bean): RCOM_1362920Help
Entry
RCOM_1362920      CDS       T01087                                 

Definition
isocitrate lyase, putative (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:rcu01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:rcu00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 576 aa AA seqDB search
MAASFSGPSMIMEEEGRFEAEVAEVQAWWNSERFKLTRRPYTARDVVALRGNLKQSYASN
ELAKKLWRTLKTHQANGTASRTFGALDPVQVTMMAKHLDSIYVSGWQCSSTHTTTNEPGP
DLADYPYDTVPNKVEHLFFAQQYHDRKQREARMSMSREERARTPYVDYLKPIIADGDTGF
GGTTATVKLCKLFVERGAAGVHIEDQSSVTKKCGHMAGKVLVAISEHINRLVAARLQFDV
MGVETLLVARTDAEAANLIQSNVDTRDHQFILGVTNPNLRGKSLATLLATGMANGKTGAE
LQAIEDNWLAMAQLKTFPECVMDAIKNMNAGEDEKRRRMNEWMNHTSYDKCLSYEQGREI
ADRMGLKNLFWDWDLPRTREGFYRFKGSVMAAVVRGRAFAPHADIIWMETAKPDFAECTA
FAEGVKSMHPEIMLAYNLSPSFNWDASGMTDEQMRDFIPRIARLGFCWQFITLGGFHADA
LVIDTFAKDYARRGMLAYVERIQREERKNGVDTLAHQKWSGANYYDRYLKTVQGGISSTA
AMGKGVTEEQFKETWTRPGAMEMGSAGSEVVAKARM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatctttctctggtccttctatgataatggaagaagaagggagattcgaggcc
gaagtagctgaggtgcaagcatggtggaactcagaaaggttcaagctaaccaggagaccg
tacactgcaagagatgttgtagcattgagaggcaatcttaaacaaagctatgcctcaaat
gaattggcaaagaaactgtggagaactctgaaaacccatcaagcaaatggcaccgcctca
agaacctttggtgcccttgaccctgtccaagtaaccatgatggctaaacacttggacagc
atttatgtttctggttggcaatgttcatcaactcacactaccaccaatgagccaggtcct
gatcttgctgattatccttatgacactgtccccaacaaagttgaacatctattctttgct
cagcaatatcatgacaggaagcaaagagaggctagaatgagcatgagccgcgaggagagg
gctagaaccccttatgttgattatcttaagccaattattgctgacggggatactggattt
ggcggaactaccgctaccgttaagctttgtaaattgttcgttgagcgtggagcggctggt
gttcatattgaggatcagtcttctgttaccaagaaatgtggtcatatggcagggaaagtg
cttgttgctattagtgaacatattaatagacttgttgcagcaaggttgcagtttgatgtt
atgggtgtggagacacttttggttgcaagaactgatgccgaggcagctaatttaattcaa
agtaatgtggatactagagatcatcagttcattttgggtgttactaatccaaatcttaga
gggaaaagcttggctacccttttggcaactggaatggctaatggtaaaacaggagctgaa
cttcaagctattgaggacaattggctagcaatggcacagcttaagacatttcccgaatgt
gtaatggatgcaattaagaatatgaatgccggagaagatgagaagagaaggagaatgaat
gaatggatgaatcatactagctatgacaagtgcctttcttatgagcaaggaagggagatt
gctgatagaatggggctcaagaatctcttctgggattgggatttgccaagaacaagggaa
gggttttatagatttaaaggttctgttatggctgctgttgttcgcggcagggcttttgct
cctcatgctgatattatctggatggagactgcaaagccagacttcgctgaatgcaccgca
tttgcagaaggggtgaaatccatgcacccagaaatcatgttagcttataatctttcacca
tctttcaactgggatgcatcaggaatgaccgatgaacaaatgagagatttcattcccagg
atagccaggttgggattctgttggcagtttataacactgggaggtttccatgctgatgcc
ctcgtgattgatacgtttgcaaaagactatgccaggaggggaatgctggcatatgtggag
aggatccagagagaggaaaggaaaaatggggttgacactcttgcccatcagaaatggtcc
ggtgctaactattatgataggtacctgaaaacagtccagggaggtatctcttccactgct
gccatggggaaaggggtgaccgaagagcagttcaaagagacatggacaaggcctggggcg
atggaaatgggaagtgcagggagcgaggtggttgccaaggcaaggatgtag

DBGET integrated database retrieval system