KEGG   Ricinus communis (castor bean): RCOM_1416900Help
Entry
RCOM_1416900      CDS       T01087                                 

Definition
GTP cyclohydrolase I, putative (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RCOM_1416900
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     RCOM_1416900
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 469 aa AA seqDB search
MGALDEGHFNLELENGVKLDCLELGFQEQTETLAIENAVSVLLQGLGEDINREGLKKTPL
RVAKALLYGNRGYKQNANDIVHSALFPESGLDNAVGHAGGAGGLVIVRDLDLFSYCESCL
LPFQVKCHIGYVPSGQRVVGLSKLSRVADVFAKRLQGPQRLANEICSALHHGIKPAGVAV
ILQCLHIHFPSFGSLLLDSNHQGFVKALVHSGSGVFETETADTWCDFLSLLKFRGINVDK
DHLKGSMEQCWCPSQSSSSSKILTKIGLPNPEMVSAVTSILTSIGEDPLRKELVGTPSRF
VKWLMNFHNTNLEMKLNGFGCNRMDPLKANGGVSHNKEQLQSELNLSFWSQCEHHLLPFY
GVVHIGYFQAEGFNPIGKSLLQSIVHFYGFKLQVQERLTRQIAETASSILGGNVMVVVEA
NHTCMISRGIEKFGSNTATIAVLGRFSTDPSSRAMFLQSIPNSAACGGL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccttggatgaggggcatttcaatttggaacttgagaatggagtgaaactcgac
tgccttgagctgggatttcaagagcaaactgagactttagctattgagaatgctgtgagt
gttctactgcaaggtcttggcgaggatatcaacagagaaggtctcaaaaagactccactt
cgtgttgccaaggcccttctttatggaaacagaggttataaacagaatgcaaatgacatt
gttcacagtgcattattccctgaatctggtttggataatgcagtaggtcatgcaggagga
gctggagggcttgtgattgtgcgagatcttgaccttttctcttactgcgaatcctgcttg
cttccatttcaggttaagtgtcacataggttatgtcccatctggtcagagggttgtagga
ctaagcaagctctctagagttgctgatgtctttgcaaaacgactgcaaggcccacagcgt
ctagcaaatgagatctgttcagctctgcaccatgggatcaaaccagcaggtgttgctgtt
attctccaatgtttacacattcattttccaagttttggatcattgttactcgactccaac
catcaggggtttgtgaaagcactagtccattccgggtctggtgtttttgaaactgaaact
gctgatacatggtgtgactttttgagccttcttaagttcagaggtataaatgtggataaa
gatcatttgaaaggctctatggagcagtgttggtgtccatcccaatcttcttcgagttct
aaaattttaacaaagattggactgccaaacccagaaatggtctccgcagtgacgtcaatt
ctcacatctattggggaagaccctctaaggaaagagcttgttggaactcccagtcgtttt
gtgaagtggctgatgaacttccataatacaaatctggaaatgaagttgaatggctttggc
tgtaataggatggatcctcttaaagccaatggcggtgtcagccataacaaagaacagctg
caatctgagctcaacctgtcattctggtctcagtgtgagcatcatttgctgcccttttat
ggagttgtgcatattggttatttccaagctgagggattcaatcccattggaaaatctctt
ctacagtccattgtacatttctatggtttcaagctccaagtgcaggaaagacttaccagg
cagattgcagagactgcttcatcgattttgggtggaaatgtgatggtggttgtggaggct
aaccatacttgtatgatttctagaggtattgaaaagtttggaagtaatacagctacgatt
gctgtacttggtcgattttcaacagatccttcttcaagggccatgtttttgcagagcatt
ccaaattctgctgcttgtggaggattatga

DBGET integrated database retrieval system