KEGG   Ricinus communis (castor bean): RCOM_1432330Help
Entry
RCOM_1432330      CDS       T01087                                 

Definition
cyclin h, putative
Orthology
K06634  
cyclin H
Organism
rcu  Ricinus communis (castor bean)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    RCOM_1432330
  Replication and repair
   03420 Nucleotide excision repair
    RCOM_1432330
Transcription machinery [BR:rcu03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     RCOM_1432330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 312 aa AA seqDB search
MADFQTSTHRVKWIFTPQQLVEKHKATNQRAKQMLEKYGTTRMEVDVDGSISYPEPQVNT
GDNADKHSRPKSLSVDEEQFMRATALIYFKRFYLQWSVMEHDPKHIMLTCIYAACKIEEN
HVSAEELGKGISQDHQMILNYEMIVLQSLDFDLIVYAPYRSVEGFINDMEDFCHATDDQT
QMLKDLQVSAVAEVDKIMFTDAPLLFPPGQLALAALRSANGMHRVLDFERYLRDILSRQN
LVHTISNLTESLDAIDSWVKKYKFPTEKDMKHINRKLKSCWGHSSHDEKNREKKSKHKSH
KSSNEMQNGPSM
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggccgattttcaaacctcgactcacagagtcaagtggatcttcactcctcaacagctg
gtagagaagcacaaagctactaatcaaagagccaaacaaatgttggagaaatatggcaca
acaagaatggaggtagatgttgatgggtcaatatcatatcctgaacctcaagtgaacact
ggagacaatgctgataaacattctcgtccaaagtcattgagtgttgacgaagaacaattt
atgcgagctacggcactcatatactttaaaagattttaccttcaatggtcggtcatggag
catgatccaaaacacataatgttaacctgtatatatgcagcatgtaagattgaagaaaat
catgtatctgcagaggagcttggtaaggggatttctcaggatcatcaaatgattctcaat
tacgagatgattgttcttcagagtttggactttgatcttattgtatatgctccataccgt
tcagttgaaggttttatcaatgatatggaggacttctgccatgcaacggatgatcagact
caaatgttgaaggatttgcaagtaagtgcagtagcagaagttgacaaaatcatgtttact
gatgcaccattgctttttcctccggggcagttagcattggctgctttacgaagtgcaaat
gggatgcatcgtgtgcttgattttgaaagatacctaagggacattctctctcgtcagaat
ttggtgcatacaatttcaaatctcactgaatctctagatgcaatagattcttgggtaaag
aagtacaaattccctacagaaaaggatatgaagcacattaataggaagctgaagtcttgt
tggggtcatagctcgcacgacgaaaagaatcgggagaagaaatcaaaacacaagtcccat
aagagttcaaatgaaatgcaaaatggcccgtccatgtag

DBGET integrated database retrieval system