KEGG   Ricinus communis (castor bean): RCOM_1434600Help
Entry
RCOM_1434600      CDS       T01087                                 

Definition
protein disulfide isomerase, putative (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     RCOM_1434600
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 362 aa AA seqDB search
MWSSKLMFEISISLAALLLFASSVLADDVVVLTDDNFEKEVGKDRGALIEFYAPWCGHCK
KLAPEYEILGTSFRKAKSVLIGKVDCDAHKSLCSKYDVSGYPTIKWFPRGSLEPKKYEGA
RTAEALAEFVNSEGGTNVKIAAVPSNVLVLTPDNFNQVVLDETKDVLVEFYAPWCGHCKQ
LAPTYEKVAAAFKLEEDVVIANVDADKYRELAEKYGVSGYPTLKFFPKSNKAGEDYGGGR
DLNDFVTFINDRCATSRDEKGKLTSKAGIVATLENLVKEFISADNDKKKEILAQMEEEVE
KLKGTIARYGKIYLKAANKCLDKGADYPKNEIQRLERVLEKSISDVKADELTLKKNILSN
FA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtggagctcaaaattaatgtttgaaatatctatatccctagctgctttgttgctattt
gcatcatcagttttggcagacgacgtcgttgtgctcaccgatgacaacttcgagaaagag
gtcggcaaagatcgcggcgctcttatcgagttctacgctccttggtgtggccactgtaaa
aagcttgctccagaatatgagattcttggcacaagtttcagaaaggcaaagtcggttttg
attgggaaggtggactgtgatgcacataagagcctctgcagcaaatatgatgtttctgga
taccccactattaaatggtttcccagagggtccttggaacccaaaaagtatgaaggtgca
cgtactgcagaagcccttgctgaatttgtgaattctgaaggaggaaccaatgttaagata
gctgctgttccgtccaatgtacttgtactaacgccagacaatttcaatcaagtcgtcctg
gatgaaacaaaagatgttctggtcgagttctatgctccatggtgtggccattgcaaacaa
cttgccccaacttatgaaaaggttgctgcggcatttaaattggaggaagatgtcgttatt
gctaatgttgatgctgacaaatacagagagttagctgaaaagtatggtgtaagtggttat
cctactctgaaattctttccgaagagcaacaaagctggtgaagactatggtggtggaagg
gatttgaatgactttgtaactttcatcaatgacagatgtgctactagtcgtgatgagaaa
gggaaacttacttcaaaggctggtatagttgctactttggagaacttggtgaaagagttt
atcagtgctgacaatgacaaaaagaaagaaatccttgcccagatggaggaagaagttgag
aagcttaagggtaccattgcaagatatggcaagatctatctgaaggctgccaataaatgt
ttggataaaggtgcagattaccccaaaaatgaaatccagcggcttgagcgtgtacttgaa
aagtcaatcagtgacgtaaaggcagatgagctcacgctcaagaagaacatcttgtcaaac
tttgcttga

DBGET integrated database retrieval system