KEGG   Ricinus communis (castor bean): RCOM_1443610Help
Entry
RCOM_1443610      CDS       T01087                                 

Definition
acetyl-CoA synthetase, putative (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_1443610
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    RCOM_1443610
   00620 Pyruvate metabolism
    RCOM_1443610
   00640 Propanoate metabolism
    RCOM_1443610
Enzymes [BR:rcu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     RCOM_1443610
Lipid biosynthesis proteins [BR:rcu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   RCOM_1443610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 749 aa AA seqDB search
MKPATSSLSPPVKVKPSISVTRRFSSSCSFSSSSSTAAFVCRRSEIWMANHNLKTTENHL
RHVESMATLPNGAGKIPRLNAVILGESLASEEDDLVFPNDDFSRRALLSSPQQYLEMYKK
SIEDPAGFWSEIASQFYWKQRWGQGQPVCSENFDVRQGSIKIEWFKGGVTNICYNCLDRN
VESGNANKIALYWEPNEPGSEDSLTYSQLLQRVCQLANYLKDKGVKKGDAVVIYLPMLME
LPIAMLACARIGAVHSVVFAGFSSESLAQRIVDCKPKVVITCNAVKRGSKVIPLKDIVDA
ALVESAKNGVSVGVCLTYENLSAMKRESTKWQDGRDVWWQDFVPNYPTTCEVEWVDAEDP
LFLLYTSGSTGKPKGVLHTTGGYMVYTATTFKYAFDYKPSDVYWCTADCGWITGHSYVTY
GPMLNGATNVIFEGAPNYPDSGRCWDIVDKFRVTIFYTAPTLVRSLMRDGDEYVTRYSRK
SLRILGSVGEPINPSAWRWFFNVVGDSRCPISDTWWQTETGGFMITPLPGAWPQKPGSAT
FPFFGVQPVIVDEKGVEIEGECSGYLCVKSSWPGAFRTLYGDHERYETTYFKPFPGYYFS
GDGCSRDKDGYYWLTGRVDDVINVSGHRIGTAEVESALVSHPQCAEAAVVGVEHEVKGQG
IYAFVTLVEGVSYSEELRKSLILTVRNQIGAFAAPDKIHWAPGLPKTRSGKIMRRILRKI
ASRQLDELGDTSTLADPNVVDQLIALADS
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggcaacaagctcactatcgccaccagtcaaagtcaaaccttcaatttcggtg
actcggcgtttctcctcctcctgctcattctcctcctcctcctccaccgccgcctttgtt
tgccgccgcagtgagatctggatggcgaatcataatctgaaaacgacggagaatcacctg
agacatgtggagtcaatggcgacattgccgaatggtgccggtaaaattcctcgtcttaac
gccgttatattaggagaatctttagcttctgaagaggacgatcttgtttttcctaacgat
gacttctcacgacgagctcttctgtcgtctcctcaacagtatttggagatgtacaagaag
tccattgaagatccggcaggattttggtcggagattgcttctcagttttactggaaacag
aggtggggccaaggtcaaccggtttgctccgagaattttgatgttcgccaagggagtatc
aagatcgagtggttcaagggaggtgtcaccaacatttgttataactgtttggatagaaat
gttgaatctggaaatgctaataagattgctctttattgggagcctaatgagcctggctct
gaggattctttaacctattctcagcttcttcaaagagtttgccagctagccaattacttg
aaagataaaggtgttaagaagggtgatgctgttgtgatttatttacctatgctcatggaa
cttcctattgcaatgctcgcttgtgcccgcattggtgctgttcactcggttgtgtttgct
ggattttcttctgaatctcttgctcaaagaattgtggattgcaaaccaaaagttgtaatt
acttgcaatgctgttaaaagaggttctaaagttattccccttaaggacatagttgatgct
gcccttgtcgaatctgctaaaaatggtgtttctgtcggtgtatgtttgacctatgaaaac
ctatctgctatgaagagggaaagcactaaatggcaggatggaagagatgtatggtggcag
gattttgtgcctaattatccaactacttgtgaagtggagtgggttgatgcagaagatcca
ctttttctgctatatactagtgggagcacaggaaagccaaagggtgttctccatacaact
ggaggatatatggtttacactgccacaacattcaagtatgcatttgattataagccatct
gacgtctactggtgcacagccgactgtggttggatcaccgggcacagctatgtaacgtat
ggaccgatgctcaatggagcaactaatgtcatttttgaaggggctcccaattatcctgat
tctggacgctgttgggatattgttgacaaattcagagtgacaatattttacactgccccc
acattggtgcggtccctcatgcgtgatggtgatgagtatgttactcgctattcacgtaaa
tccttaaggatccttggaagtgtaggcgagcctattaatccaagtgcttggaggtggttt
ttcaatgtagttggagattcacgatgccctatatcggacacttggtggcaaactgaaact
ggtggttttatgattactccactaccaggtgcttggccacagaagcctggttctgcaacc
tttcctttctttggagttcagcctgtgatagtggacgaaaagggtgttgagattgaagga
gagtgtagtggatatctctgtgtgaaaagctcatggcctggggcattccgaactctttat
ggcgatcacgaaagatatgaaaccacttacttcaagccatttcctggctattatttcagt
ggtgatggctgtagcagggacaaggatggatactactggcttactggaagagtcgatgat
gttatcaatgttagtggtcatcgtattggcacagcagaagtggaatctgctcttgtatct
catccccagtgtgcagaagctgctgtagttggcgttgagcatgaggttaaaggacagggc
atttatgcatttgtcacacttgtggagggcgtttcttacagtgaagaactccgaaaaagt
cttatcctcacagtccgaaatcaaataggagcatttgcagcaccagacaaaattcactgg
gctcctggccttccgaagacaagaagtggaaagataatgaggaggattctgagaaaaatt
gcttccaggcagttagatgaacttggggacacaagcactctggcagatccaaatgtggtt
gaccagcttatagcacttgctgatagctga

DBGET integrated database retrieval system