KEGG   Ricinus communis (castor bean): RCOM_1449150Help
Entry
RCOM_1449150      CDS       T01087                                 

Definition
DNA replication licensing factor MCM4, putative
Orthology
K02212  
DNA replication licensing factor MCM4 [EC:3.6.4.12]
Organism
rcu  Ricinus communis (castor bean)
Pathway
DNA replication
Module
MCM complex
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RCOM_1449150
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     RCOM_1449150
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 867 aa AA seqDB search
MASDSFNNGPSSPDDSFSSPIGNTFSSPATRGNTRRSRSSASAYATPPPPQSRFPASEST
PTPRRSNGHHAATSTPSSMSEGVPPSSEGGDDMEDATPTFVWGTNISVQDVKGKIQMFLK
HFRDLNKSQSQGAEVFEEGKYMKGINRVLEIEGEWLDVDGHDVFDYDSDLYNKMVRYPLE
VLAIFDIVLMDIVSLINPLFDKHVQVRIFYLKTSTTMRNLNPSDIEKMVSLKGMIIRCSS
IIPEIREAIFRCLVCGYLSDPIVVDRGRINEPTNCSKEECLARNSMTLLHNRCRFADKQI
VRLQETPDEIPEGGTPHTVSLLLHDKLVDTGKPGDRVEVTGIYRAMSVRVGPTQRTVKSL
FKAYMNIMVFSFCLQTYIDCLHIKKTDKSRMTTENPMEIDDGLHRTEDDVQFDEAKACLS
IFFSSGKNLCYCCLLGSYSCLNLQIKQLKELSEQPDIYDRLTKSLAPNIWELDDVKRGLL
CQLFGGNAVKLPSGASFRGDINILLVGDPGTSKSQLLQYIHKLSPRGIYTSGRGSSAVGL
TAYVSKDPETGETVLESGALVLSDRGICCIDEFDKMSENARSMLHEVMEQQTISIAKAGI
IASLNARTSVLACANPIGSRYNPRLSVIDNIHLPPSLLSRFDLIYLILDKADEQTDRHLA
KHIVSLHFENPESAQHNVLDIATLTAYLSYARKHIHPKLSDEAAEELTRGYVEMRRRGNF
PGSSKKVITATPRQIESLIRLSEALARIRFSEWVEKHDVIEAFRLLEVAMQQSATDHSTG
TIDMDLITTGVSASERMRRENLVSATRNIIMEKLQLGGPSMRLLEIMEELKKQNTSNEVH
LQDLRNAVANLASEGFVVVHGDSVKRI
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgattctttcaacaacggtccttcatcaccagatgattcattctcaagtcca
atcggcaacacattctcatctccagctacacgtggaaacacgcgcagaagcagatcttct
gcttctgcctatgcgactccacctcctccacaatcccgctttcctgcttcagaatcaact
ccaactccccgcagatccaatggccaccatgctgccacgtcaactccatcttccatgtca
gaaggggtaccaccttcctccgaaggaggcgatgacatggaagacgccacccctacgttt
gtttggggtactaatattagtgtgcaggatgtgaagggcaaaatacaaatgtttttgaag
catttcagggatttgaataaaagtcaaagtcaaggggctgaggtgtttgaagaagggaag
tatatgaaggggataaatagagtgttggaaattgaaggagaatggcttgatgttgatggg
catgatgtgtttgattatgattctgatttgtataataaaatggttaggtatccacttgag
gttttggctatttttgatatcgttttgatggatattgttagtttgattaatcctttgttc
gacaagcatgttcaagtcaggattttttatctcaagacttctactactatgagaaatctt
aacccttctgatatcgagaagatggtttcgctcaaaggaatgataattcgatgcagttct
ataataccagagatcagggaagcaatatttagatgccttgtatgtggctacttatcagac
cctattgttgtggatagaggaaggataaatgaacctacaaattgctcgaaggaagagtgc
cttgctagaaactctatgacattgcttcataatcggtgcagattcgctgataagcagatt
gtgaggctccaggagacacctgatgagattcctgaaggaggaacaccacacacggtgagc
ttgttgttgcatgacaagctggtagatactggaaagcctggtgatagagttgaggtcact
gggatttatagagctatgagtgtcagagtcggacccacacagagaactgtaaaatcatta
ttcaaggcatacatgaatataatggtcttttccttttgcttgcagacttacattgactgt
cttcatataaagaaaactgacaagtcaagaatgacgacggaaaatcctatggaaattgat
gatggcttgcatagaacagaggacgatgtccaatttgatgaagctaaggcatgtttgtca
atatttttctcttctggaaagaacttgtgttactgttgtctgcttggatcatattcttgt
ttgaacctgcagataaagcaattgaaggagctctctgaacagcctgatatttacgacaga
ctaacaaagtctctggcaccaaacatttgggagcttgatgatgtgaagagaggccttctc
tgccagctctttggtggaaatgctgtgaagttgccatctggtgctagcttccgaggggat
atcaacatccttcttgttggtgatcctggaaccagtaagtcccagctgctccaatacata
cacaaattatctccccgtggcatctatactagcggaagaggaagttctgctgttggcttg
actgcctatgtcagcaaagatcctgagacaggggaaacggttctggagagtggagcactt
gtcctgagtgaccgaggaatctgttgtattgatgaatttgacaaaatgtctgaaaatgca
aggagcatgttgcatgaggtgatggaacagcaaactatttctattgcaaaggctggaatt
attgcttcccttaatgctagaacttcagtattagcttgtgcaaatcctattggttcgcgc
tataatcctaggttgtctgtaattgacaacatacaccttcctccttccttgttgtccagg
tttgacctaatatacttaattcttgacaaggctgacgaacaaacggacaggcaccttgcc
aagcatattgtttcgttacactttgagaatcctgagagtgctcaacacaatgtcttagac
attgctacattaactgcatacttgagttatgctcgtaagcatattcacccaaagttatct
gatgaagctgctgaagagttgactcgtggatatgttgagatgaggagaagagggaacttt
cccggcagtagcaaaaaggtaataactgcaacacctaggcagatagaaagtctgatacgc
ctgagtgaagctctggctcgaatacgtttctcagaatgggttgagaagcatgatgtgatt
gaggcatttcgacttctggaagtggcaatgcaacagtcagcaacggatcattccacagga
actattgatatggatctcatcacaactggagtttcggcaagtgaaaggatgagaagagag
aatcttgtatcagcaacccgcaacattattatggagaagttgcaacttgggggaccttca
atgcgcttgctggagataatggaagaactgaagaagcagaacactagcaacgaagttcat
cttcaagatctgaggaatgcagttgcaaatctagcaagtgaagggtttgtagttgtgcat
ggcgacagtgtaaaaaggatatag

DBGET integrated database retrieval system