KEGG   Ricinus communis (castor bean): RCOM_1453740Help
Entry
RCOM_1453740      CDS       T01087                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     RCOM_1453740
Peptidases [BR:rcu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   RCOM_1453740
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 605 aa AA seqDB search
MQQNTKFTQKPKALNKPQIGFKIKLPVMQVRERRRGTASKTKAIGRRRVVVVVVVAGHGV
VGGEEEKDSIFFNFLNCEMRRVGERERVVLVFGSFTEDETKSWQANKSSENDKKPVQKKE
LQFGSLNFATGITFGDFSSESSRQPGSTNGKVSFQSTNPHKKEKDVKIAINPEPSVLGSP
KQNGSIADITHSVTLANGVKGLKTESLDLASLHLSQNEDSPINLSQSSNFHVLDSGAVKG
GDLDGINNNSLVYVENENTRKPCDEPVAAALLSCSPFVQLLQNLRTRNIPKVGFPTLTAF
AQFVSEFDMPSSSSLKKDTAIVETGRPFSPAMFEGVLKKFTPDVPNCISGRPRQEDAQEF
LSFIMDQMHDELLKLEGQFACTNGAKSSLVSSTEDDEWETVGPKNKSAVTRTQSFIPSEL
SDIFGGQLRSVVKATGNKASATVQPFLLLHLDIYPEAVRTIEDALHLFSALENLEGYRAP
VTGKAGIVTARKSVKIQTLSKIMILHLMRFSYGSQGSTKLHKPVHFPLELVLGRELLVSP
STESRKYELVATITHHGREPSKGHYTADARCPNGHWLHFDDASVTAIGTSKVLHDQAYVL
FYRQV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaacactaaattcacccaaaagccaaaggctttaaacaagcctcaaattggg
ttcaagatcaaacttccagtcatgcaagtaagggaaagaaggagaggcactgcgagcaag
actaaagcaatcggaagacgaagagtggtggtggtggtggtggtggctgggcatggcgtt
gttggtggagaggaagaaaaagattcgatttttttcaactttttgaactgtgaaatgagg
agagtgggagagagagagagagtggttctagtattcggatccttcactgaagatgaaacc
aagtcatggcaggcaaacaaatcatctgagaatgataagaagcctgtgcagaagaaagaa
ttgcaattcggttctttgaattttgcaactggtataactttcggtgattttagtagtgaa
tcgagtaggcagccgggttctacaaatggaaaagtcagttttcagagtacaaatccacac
aagaaggaaaaggatgtgaagattgcaataaaccctgagcctagcgtgctgggaagtcca
aaacaaaatggaagcattgctgatatcacccacagcgttacccttgctaatggtgttaaa
ggcttaaaaacggagagtttggacttggcttccttgcacttatcacagaatgaagatagt
cccataaatctatcacaaagctcaaactttcatgttcttgatagtggagcagtaaagggt
ggggatttggatggaattaataataattcactagtatatgtggaaaatgagaacaccagg
aaaccatgtgatgagcctgttgcagctgctcttttatcctgttccccttttgttcagctc
ttgcagaatctcagaactcgcaacatcccaaaggttggctttccaacattaacggcattt
gcacagtttgtctctgagtttgacatgccaagcagttccagcttgaagaaagacacagct
attgttgagactggtaggccgtttagccctgccatgtttgaaggcgttcttaaaaaattt
actccagatgtgccgaattgcatatcaggacgacccaggcaggaggatgctcaggagttt
ttaagttttataatggatcaaatgcatgatgaattactcaagcttgaaggacaatttgct
tgcacaaatggtgccaaatcatctcttgtctcttcaacagaggatgatgagtgggagaca
gtaggcccaaaaaacaaatctgctgtgactagaacacaaagcttcattccttcagagcta
agtgatatttttggaggacagttgagaagtgtcgtgaaagcaacaggaaataaagcttct
gcaactgttcaaccatttctattgcttcaccttgacatttatcctgaggctgtacgtact
attgaggatgcacttcatttgttctctgcactcgaaaatcttgaagggtatcgggcaccg
gtaactggaaaggctggtatagtgactgctagaaagtctgtgaagatacagacactttct
aagataatgatattgcacctgatgcgctttagttatggaagccaagggagcaccaagttg
cacaagcctgtgcactttccccttgaattggtgttgggtcgagaattactcgtttctcct
tcaactgagagccggaaatacgaacttgttgcaacaataactcatcatgggagagagcct
tcaaagggtcattatacagctgatgctcggtgtcccaacggccattggcttcattttgat
gatgcatctgtcactgcaattggtacgagtaaagtcttgcatgaccaggcctatgtcctc
ttctacagacaagtatag

DBGET integrated database retrieval system