KEGG   Ricinus communis (castor bean): RCOM_1479000Help
Entry
RCOM_1479000      CDS       T01087                                 

Definition
calcium-dependent protein kinase, putative (EC:2.7.11.17)
Orthology
K13412  
calcium-dependent protein kinase [EC:2.7.11.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:rcu04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 536 aa AA seqDB search
MGNCCSRGDSGDAAENEKGEAVANNTNGSVANNANQENSTTPPPKSTAPTSPSPAASPKP
AKAAPIGPVLGRPMEEVKSVYTIGKELGRGQFGVTHLCTHKATGEQFACKTIAKRKLVNK
EDVEDVKREVQIMHHLTGQPNIVELKGAYEDKHSVHLVMELCAGGELFDRIIAKGHYTER
AAASLLRTIVQIVHTCHSMGVIHRDLKPENFLLLNKDENSPLKATDFGLSVFYKPGEVFK
DIVGSAYYIAPEVLKRRYGPEADIWSVGVMLYILLSGVPPFWAESEHGIFNAILRGHVDF
TSDPWPQISPQAKDLVRKMLNSDPKQRLTAIQVLSHPWIKEDGEAPDTPLDNAVLSRLKQ
FKAMNNFKKVALRVIAGCLSEEEIMGLKEMFKGIDTDNSGTITLEELKQGLAKQGTKLSE
YEVKQLMEAADADGNGTIDYDEFITATMHLNRMDREEHLYTAFQHFDKDNSGYITTEELE
QALREYGMHDGRDIKEIISEVDSDHDGRINYDEFVAMMRKGNPEANPKKRRDTVFV
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgggcaactgttgctctcgtggggactctggtgatgctgcagaaaatgaaaaaggggag
gcagtagctaataatacaaatggcagtgttgctaacaatgctaaccaagaaaactccacc
actcctcctcctaagtcaactgctccaacttctccttctccggcagcttctcctaaaccg
gccaaggctgctcctatagggccggtcttaggccgcccgatggaggaagtaaaatcggtt
tacaccattggcaaagaacttggtagggggcagtttggtgttacacatttgtgtacgcat
aaggccacaggcgagcagtttgcatgcaagacaatagccaaaagaaagcttgtaaacaag
gaagatgtggaggatgttaagagggaggttcagattatgcatcatttaacaggccagcct
aacattgtggagctcaaaggagcttacgaggataaacattctgttcatttggtgatggag
ttgtgtgccggtggagaacttttcgaccgaattatcgctaagggtcattacacagaacgt
gctgctgcttctttgcttaggactattgttcaaattgttcatacatgtcattccatgggt
gttattcatagagatctcaagcctgaaaacttccttttgcttaataaagacgagaattcc
cctctcaaagctacagattttggcctttcagtgttctacaagccaggagaggtgttcaaa
gatattgttgggagtgcttattacatagcacctgaagtgttgaagaggagatatggacca
gaagcagatatatggagtgttggggtcatgttgtatattcttttaagtggtgttccacct
ttttgggctgaatctgaacatgggatattcaatgcaattttacgtggccatgttgatttt
acaagtgatccttggcctcaaatttcacctcaagctaaggatcttgtccggaaaatgcta
aattcagacccaaaacagaggttgacagccatccaggttctaagtcatccatggatcaag
gaggatggagaagctcctgatactcctcttgacaatgcagtattgagtaggctcaaacaa
ttcaaagcaatgaataatttcaagaaagttgctttaagggttattgctggctgtctatca
gaggaagaaattatgggattgaaggaaatgttcaagggcatagacactgacaatagtggc
accattacacttgaagagctgaagcaagggcttgccaagcaagggacaaagctatccgaa
tacgaagtcaaacaactcatggaagccgctgatgcagatggcaatggaaccatagactat
gatgaatttatcacagcaacgatgcatttgaacagaatggacagagaagaacatctttac
acagccttccagcattttgataaagataatagcgggtacatcacaactgaagagctggag
caagcacttcgtgaatatggaatgcacgatgggagggacattaaggaaatcatttctgaa
gttgacagtgaccatgatggaagaataaactatgatgaatttgtggcaatgatgaggaaa
ggaaacccagaagcaaacccaaagaaaaggcgtgacactgtatttgtttga

DBGET integrated database retrieval system