KEGG   Ricinus communis (castor bean): RCOM_1488110Help
Entry
RCOM_1488110      CDS       T01087                                 

Definition
profilin, putative
Orthology
K05759  
profilin
Organism
rcu  Ricinus communis (castor bean)
Brite
Exosome [BR:rcu04147]
 Exosomal proteins
  Proteins found in most exosomes
   RCOM_1488110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 132 aa AA seqDB search
MSWQTYVDDHLMCDVGDGHTLTAAAIIGHDGSVWAQSATFPQLKPEEVTAIMKDFDEPGS
LAPTGLHLGGTKYMVIQGEPGAVIRGKKGSGGATLKKTGQAIVIGIYDEPLTPGQCNMVV
ERLGDYLIDQGL
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcaaacatatgttgatgatcatcttatgtgcgatgtcggagatggccatact
ctcacggccgccgccatcatcggccacgatggcagcgtgtgggcccagagcgccaccttc
ccacagttgaaaccagaagaggttactgcaatcatgaaagattttgatgaacctggatct
cttgccccaactgggttgcaccttggtggcacaaagtacatggtgatccaaggagagcct
ggagctgtgattcgtggaaagaaaggttctggtggcgccactctgaagaagaccgggcaa
gctattgttattggcatttacgacgagccattgaccccaggacagtgcaacatggtagta
gagaggctgggtgattacctcattgatcagggcctgtag

DBGET integrated database retrieval system