KEGG   Ricinus communis (castor bean): RCOM_1500180Help
Entry
RCOM_1500180      CDS       T01087                                 

Definition
Pectinesterase-2 precursor, putative (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    RCOM_1500180
   00500 Starch and sucrose metabolism
    RCOM_1500180
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     RCOM_1500180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 526 aa AA seqDB search
MEIKIKLLAIFFIFFSSIIFTATSISSKTNVTWWCSQTPHPETCKYFIGHRLQRVALKHR
SEFRKITVQVALERALSAQKKVSKLRPKCQDHHQRAVWVDCHKLHSDTIVQLNRTLQGLA
AKKKKSCTDFDAQTWLSTALTNIQTCRTGSLDFNVSDFIMPIVSSNLSKLISNGLAINGV
LLSVQNNSIEGLFPRWFSRKERRLLQAPSIKANLVVAQDGSGHFRTVQAAINAAAKRRYG
TRFVIHVKKGVYRENIEVGINNNNIWLVGDGLRNTIITSGRSVGAGYTTYSSATAGIDGL
RFVARGITFRNTAGPLKGQAVALRSASDLSVFYRCSFEGYQDTLFVHSQRQFYRECYVYG
TIDFIFGNAAVVFQNCIIYVRRPLKGQANMITAQGRNDPFQNTGISIHNSRILPAPDLKP
VVRAVQTYLGRPWMQYSRTVVLKSYIDSFIHPAGWSQWQGSNFALNTLYYAEYKNFGPGS
STRRRVKWKGYHVITSSTVASSFTVGRLIAGQSWLPATGVPFISGL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcaagattaaactgttagcgatttttttcatcttcttttcttcaataatcttc
actgctacatcgatatcctctaaaaccaatgttacctggtggtgcagccagacaccacat
cctgaaacttgcaagtacttcattggccacagactccaacgtgttgctctcaaacatagg
tcagaatttcgcaaaataactgtccaagttgccctagaaagagctcttagtgcacaaaaa
aaagtctccaaattaagacctaaatgccaagatcatcaccaaagagctgtatgggttgat
tgtcacaaactccattctgataccatcgttcaactaaaccgcacacttcaaggtctagct
gccaagaaaaagaaaagctgtacagattttgatgcacaaacatggctaagcactgccctg
actaacatccagacatgccggacagggtctttagactttaacgtgtcagattttatcatg
ccaatcgtctccagtaatctatctaagcttataagcaacggtctagctattaatggagtt
ttgctttctgttcaaaataatagtatagaaggattatttccaagatggttctcaaggaaa
gagaggaggctattgcaagctccatcaatcaaggcaaatttggtagtagcacaagatggt
tcggggcattttaggactgttcaggcagctatcaatgcggcagcgaagaggagatatggg
actaggtttgttattcatgtgaagaaaggcgtttacagagaaaatatagaagttggcatc
aacaataataatatttggttggtcggtgatgggttgagaaataccattataacgagtggc
agaagtgttggtgctggttatacaacctacagttctgcaactgctggaatagatggtctc
cgatttgttgctcgtggcattacatttaggaacacagcaggtccactaaaaggccaagcg
gttgcacttcgatcagcttcagatctctccgtattctatcgatgttcgtttgaaggatac
caagacactctttttgtccactcacaacgtcaattctacagagaatgttatgtttatggc
accatagacttcatttttggtaacgcagcagttgttttccaaaattgtataatctatgta
aggcgacctttgaaagggcaagcgaacatgatcaccgcacagggccgaaatgaccctttc
cagaataccggaatttcaattcacaactcgcggattttaccagcacctgacttgaaaccg
gtggttcgtgcagttcagacgtacttaggaaggccttggatgcagtactccaggacagta
gttcttaagagttatattgatagtttcattcatccagctggttggtcacagtggcaaggc
agcaactttgctttgaacacgttgtattatgcagagtataagaattttggacctgggtct
tccaccagacggagagttaaatggaaaggatatcatgttataactagcagcactgtagcc
tcaagtttcacggtcggtcggcttattgctggccagtcatggttgccagcaactggtgtt
ccatttatctctggcctatga

DBGET integrated database retrieval system