KEGG   Ricinus communis (castor bean): RCOM_1500190Help
Entry
RCOM_1500190      CDS       T01087                                 

Definition
Pectinesterase-2 precursor, putative (EC:3.1.1.11)
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:rcu00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:rcu00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 455 aa AA seqDB search
MAIDLAMQRAITAQSHNKYLGSKCRNEKEKAAWADCLKLYEDTIIQLNHTLDPNTKCTDY
DAQTWLSTALTNLETCRAGFVELGVSDFMLPLMSNNVSKLIGNTLAINNGSSSASPQTYK
DGFPSWVKPGDRKLLQTSSSTPNLVVAQDGSGNYRTIKQALDAAAKRSGKGRFVIRIKSG
IYRENLEIGNKMKNIMLVGDGLRNTIITGSRSVGGGSTTFNSATVAVTGEGFIASGITFR
NTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYIHSQRQFYKECYIYGTVDFIFGNAA
VVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLKPVLSSFKTFLG
RPWKQYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGPASSTSGRVKWRGY
RVITSATEASQFTVANFIAGRSWLPATGVPFSSGL
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgacttagccatgcaaagagccatcactgctcaaagccacaacaagtacctt
ggctcaaaatgccgcaatgagaaagagaaggctgcatgggctgattgcttaaagctttat
gaagataccattatccaactcaatcatactcttgaccccaacaccaaatgtactgattac
gatgctcaaacttggctcagcactgctctaaccaatcttgaaacttgtagagctggattt
gttgagctaggggtttcagattttatgttgccactcatgtccaacaatgtttctaagcta
ataggcaatactttggctataaacaatggctcatcatccgcttcgccacaaacttataaa
gatggttttcctagttgggttaaaccaggtgatcggaagcttttgcagacatcttcgtcg
accccaaatctagtggtggctcaagatggttcggggaattaccggactataaagcaggcg
cttgatgcagctgcgaagaggagtggaaaaggaaggtttgtgatacgtattaaaagtgga
atttacagagagaatctcgagattggtaacaaaatgaagaatattatgttggttggcgat
gggttgaggaatactattatcaccggcagccggagtgttggaggaggctctaccactttc
aactctgcaactgttgcggtgacgggagaaggattcatagccagtggcatcacgttccgc
aacactgccggtccacaaaaccaccaagcagtggcactacgatcaggctctgatctctca
gtcttttaccgctgcggttttgaaggttaccaagacaccttgtacatccattctcaaaga
caattctacaaagagtgctacatatatggaactgtggacttcatatttggcaatgcagct
gttgtcttgcaaaactgcatgatatatgcaagaaggccaatggacaaacaaaagaacaca
ataacagcacaaggcaggacggaccctaatcaaaatacagggatttcaatccataattct
agagttatggctgcatctgaccttaaaccagtgctcagctcattcaaaactttcttaggt
aggccatggaagcagtactcgcgcacagtttttctccaaacttaccttgattctttggtg
gatccagctggttggctagaatgggatggcaattttgcattgaatactttgtattatgga
gagtataagaatatgggtcctgcttcttcaactagtggaagagttaagtggcgtggttac
agggttattacaagcgcaactgaagcatcccagtttactgttgctaacttcattgctgga
cggtcatggttgcctgccactggcgtccctttcagttctggactttga

DBGET integrated database retrieval system