KEGG   Ricinus communis (castor bean): RCOM_1505560Help
Entry
RCOM_1505560      CDS       T01087                                 

Definition
Alpha-1,4-glucan-protein synthase [UDP-forming], putative (EC:2.4.1.186)
Orthology
K13379  
reversibly glycosylated polypeptide / UDP-arabinopyranose mutase [EC:2.4.1.- 5.4.99.30]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     RCOM_1505560
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.30  UDP-arabinopyranose mutase
     RCOM_1505560
Glycosyltransferases [BR:rcu01003]
 Polysaccharide
  Structural polysaccharide
   RCOM_1505560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 362 aa AA seqDB search
MARPASHVYPPLKDELDIVIPTIRNLDFLEMWRPFFQPYHLIIVQDGDPNKTVRVPDGFD
YELYNRNDVNRVLGPKSNCISFKDSACRCFGFLVSKKKYIFTIDDDCFVAKDPSGKEINA
LAQHIQNLLTPSTPFFFNTLYDPYREGADFVRGYPFSMRGGVATAISHGLWLNIPDYDAP
TQLVKPLERNTRYVDAVLTIPKGTLFPMCGMNLAFNRELIGPAMYFGLMGDGQPIGRYDD
MWAGWCAKVICDHLDLGVKTGLPYIWHSKASNPFVNLKKEYKGIYWQEDIIPFFQSVALP
KECNTVQKCYIELSKLVKEKLGHIDPYFTKLGDAMVTWIEAWDELNSPAEGATAQTNVTK
KE
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggctcggccagcaagccatgtgtatcctccattgaaagatgaactcgacatagttatc
cctaccatcagaaacttagatttcttggagatgtggaggccattctttcagccttaccat
ctaatcattgtccaagacggggatccgaacaagactgttcgggttcctgatgggttcgat
tatgagctctataacagaaacgatgtcaatcgagttcttggacccaaatccaattgtatt
tcttttaaagactctgcttgccgctgctttggcttcctggtttctaagaagaaatatatt
ttcaccatcgatgatgattgctttgtggcgaaggatccaagtgggaaggagataaatgca
ttggcgcaacacatacaaaatttgctaacaccatcaacgcccttcttttttaacacactg
tatgatccatacagagaaggagcagattttgtaagagggtatccatttagcatgagagga
ggagtagctactgcgatatcgcatggactttggcttaacattcctgactatgatgcccca
actcagcttgtcaagcctcttgaacgtaacaccaggtatgtggatgctgttctcacaatc
ccaaaagggactctatttccaatgtgcgggatgaaccttgcttttaacagggagctgatt
ggccctgccatgtacttcggactcatgggtgatggtcaacctattggtagatatgatgac
atgtgggctggttggtgtgccaaggtgatatgtgaccatctggatcttggggtgaaaacc
ggcctaccatacatttggcacagcaaggcaagcaacccatttgtgaatttgaagaaggaa
tataagggcatatactggcaggaagatatcatcccattcttccaatctgttgccctcccc
aaagagtgcaatactgtgcaaaaatgctacattgagctttccaaactggtcaaggaaaag
cttggccatattgatccgtattttacaaaacttggtgatgccatggttacctggattgaa
gcgtgggatgagctaaattccccagctgaaggagctacggcacagaccaacgtcactaag
aaagaatga

DBGET integrated database retrieval system