KEGG   Ricinus communis (castor bean): RCOM_1507380Help
Entry
RCOM_1507380      CDS       T01087                                 

Definition
Elongator complex protein, putative (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 563 aa AA seqDB search
MATAVMSDSKKLPRPGRGGYQAHGLTEEEARVRAIAEIVNSMVELSRKNQTVDLNAIKSA
ACRKYGLARAPKLVEMIAALPESDRESLLPKLRAKPVRTASGIAVVAVMSKPHRCPHIAT
TGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYNSYVQARSRIDQLKRLGHSVDK
VEFILMGGTFMSLPADYRDYFIRNLHDALSGHTSANVEEAVAYSEHGAVKCIGMTIETRP
DYCLGPHLRQMLSYGCTRLEIGVQSTYEDVARDTNRGHTVAAVADCFCLAKDAGFKVVAH
MMPDLPNVGVERDMESFREFFESPSFRADGLKIYPTLVIRGTGLYELWKTGRYRNYPPEQ
LVDIVARILAMVPPWTRVYRVQRDIPMPLVTSGVEKGNLRELALARMDDLGLKCRDVRTR
EAGIQDIHHKIRPEEVELVRRDYTANEGWETFLSYEDTRQDILVGLLRLRKCGRNVTCPE
LMGKCSIVRELHVYGTAVPVHGRDADKLQHQGYGTLLMEEAERIARCEHRSTKIAVISGV
GTRHYYRKLGYGLEGPYMVKCLA
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgcagtaatgtccgactccaaaaagctcccacgaccgggaaggggcgggtat
caagcacatggactgaccgaagaagaagcccgtgttcgagccatagcagaaatcgtaaac
tccatggtagagctctcacgaaagaaccaaactgtagacctaaacgctatcaaatccgcc
gcatgccgcaagtacggcctcgcacgagcaccaaagctcgtggagatgatcgcggctctg
cctgagtccgaccgagaatcgctacttcctaagctccgtgccaagccagttcgtactgct
tcaggaatcgcggtcgtggccgttatgtcgaagccgcatcggtgtccgcatattgcgacc
acgggaaatatttgtgtttattgtcccggtggaccggactctgatttcgagtacagcaca
cagtcctatactggttatgaacctactagtatgcgtgcaattcgagccagatataattcg
tatgtccaggctagaagcaggatagatcagcttaagagattaggtcacagcgtagacaag
gttgagtttatattgatgggtggtactttcatgtcactgccagcagattaccgtgattat
tttataaggaatcttcatgatgcgctgtctggacacacttccgccaatgttgaagaggca
gttgcctactctgagcatggtgcagtcaagtgtattggcatgactattgaaacgagacca
gattattgtcttggacctcatctgcgtcaaatgctttcttatggttgtacacgactggag
attggagtgcaaagcacatatgaggatgttgctcgggatacaaatagaggacacacagtg
gctgctgttgctgattgtttttgcttggcaaaagatgcgggtttcaaggttgttgctcat
atgatgcctgatcttccaaatgttggggttgagagggacatggaaagttttcgagaattc
tttgaaagtccttcatttagagccgatggactcaaaatttatcctacacttgtaattcgt
ggaactgggctttatgaactctggaaaactggcagatatagaaactacccacctgaacaa
cttgtggatattgtagcacggattctagctatggtacccccttggacacgtgtttataga
gttcaacgggatattcccatgcctttggttacatctggagttgagaaaggaaatcttagg
gagctagctttagcccgaatggatgacttgggcttgaaatgccgtgatgttcgcacacgt
gaggctggaatccaggacattcatcataaaattaggccagaagaagttgagcttgttcgc
cgagattatacagctaatgaaggttgggagacatttctttcatatgaggatacacggcag
gatattcttgtgggtttgttgcgcttgcggaaatgtggtcggaacgttacctgccctgag
ctcatggggaagtgctctattgttcgtgagctccatgtttatggaactgcagttcctgtt
catggccgtgatgcagacaaattgcaacaccagggttatgggacgctattaatggaagag
gcagagaggattgcacgctgtgagcatagatcaactaagatagctgtcatttcaggcgtt
ggaacccgtcactactataggaaattgggttatgggcttgaaggcccttacatggttaaa
tgtcttgcctga

DBGET integrated database retrieval system