KEGG   Ricinus communis (castor bean): RCOM_1510580Help
Entry
RCOM_1510580      CDS       T01087                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase, chloroplast precursor, putative (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    RCOM_1510580
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     RCOM_1510580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 467 aa AA seqDB search
MALNLLSPAELKSVSFLDSTRSSQLPKLPGSFSLKRKEFGRKVQCSAQAPPPAWPGRAVA
EPGRKTWDGPKPISIVGSTGSIGTQTLDIVAENPDKFRVVALAAGSNVTLLADQVKTFKP
QLVSVRDESLVDELKEALADVDEKPEIIPGEQGIVEVARHPDAVSVVTGIVGCAGLKPTV
AAIEAGKDICLANKETLIAGGPFVLPLAHKYNVKILPADSEHSAIFQCIQGLPEGALRRI
ILTASGGAFRDWPVEKLKDVKVADALKHPNWNMGKKITVDSATLFNKGLEVIEAHYLFGA
DYDNIEIVIHPQSIIHSMVETEDSSVLAQLGWPDMRIPILYTMSWPDRIYCSEITWPRLD
LCKLGSLTFKAPDNVKYPSMELAYAAGRAGGTMTGVLSAANEKAVEMFIDEQISYLDIFK
IVELTCDKHRAELVTSPSLEEIIHYDLWAREYAASLQPSSGLSPVLA
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttaatttgctttctccagctgaactcaaatccgtttctttcttagattccacc
aggtccagtcagctccccaagcttccaggcagtttcagtttgaaaaggaaggaatttgga
aggaaagtgcagtgttcagcacaggcaccaccaccagcctggccaggaagagcagttgca
gagccaggccgtaaaacttgggatggtcctaagcctatttcaatagttggatccactggc
tctattggtactcagacgttggatattgtggctgagaatccagataaattcagagttgta
gcacttgctgctggttccaatgttactcttcttgctgatcaggttaagactttcaaacct
cagcttgtttctgttagagatgagtcattagttgatgagcttaaagaggctttagctgat
gttgatgaaaagcctgagattattcctggagagcaaggaattgttgaggttgctcgccat
ccagatgctgtcagtgtagttactggaattgtaggttgtgcaggcttgaagcctactgtt
gctgcaatagaagctggtaaagacatatgcttggccaataaagagactttaattgctgga
ggtccttttgtcctccctcttgctcacaaatataatgtaaaaattcttccagctgattcc
gaacattctgccatatttcagtgcattcaggggctgcctgagggtgcactgcggcgcatt
attttaactgcctctggtggtgctttcagggattggcctgttgagaaattgaaagatgtt
aaagtagctgatgctttaaagcatccgaattggaatatggggaaaaagattactgtagac
tctgctacccttttcaataagggactagaagtaattgaagcccattatttgtttggagct
gactatgataacattgagatagtaattcatcctcaatccattatacattcaatggtggaa
acagaggattcatctgttcttgcacagttggggtggcctgatatgcgtattccaattcta
tacaccatgtcatggcctgacagaatttactgctctgagataacctggcctcgccttgat
ctttgcaagcttgggtctttaacatttaaagctcctgacaatgtaaaatacccatctatg
gagcttgcctatgcagctggacgggctggaggcaccatgacaggagtcctcagtgctgct
aacgagaaagctgtagagatgttcatcgatgaacagatcagctaccttgacattttcaag
attgtggagctaacatgcgacaagcatcgggcagaattggtgacttcaccctctcttgaa
gaaattattcactatgacttgtgggcgcgagaatatgccgccagtttgcagccctcttct
ggtctaagtcctgttctcgcatga

DBGET integrated database retrieval system