KEGG   Ricinus communis (castor bean): RCOM_1517440Help
Entry
RCOM_1517440      CDS       T01087                                 

Definition
ATP binding protein, putative (EC:2.7.12.1)
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     RCOM_1517440
Protein kinases [BR:rcu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   RCOM_1517440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 848 aa AA seqDB search
MVKKQITEARKVVYIVKDVLGHGTFGQVAKCWVAETNSFVAVKIIKNQPAYYQQALVEVS
ILTTLNKKYDPEDKHHIVRIYDYFVFQRHLCICFELLYTNLYELIKLNQFRGLSLSIVQL
FSKQILHGLALLKDAGIIHCDLKPENILLCTSVKPAEIKIIDFGSACMEDRTVYSYIQSR
YYRSPEVLLGYQYTTSIDMWSFGCIVAELFLGLPLFPGASEFDLLRRMIEILGGQPPDYL
LKEAKNTSKFFKCIGSVHNVDHGDMSLGSKSAYQALTVDEYEVRELKKPSIGKEYFHHKN
LEAIVTNYPYRKNLPQEDIMKESQIRLALIDFLRGLVEFDPAKRWSPFQASRHPFVTGEP
FTCPYKPPPESPRMPVAQNFKVDHHPGGGHWFAAGLSPNIPGRTRASLHNSPHFQVVPYA
HGNSYGSIGSHGSYNDGIGLGSSYGSYGDGSNMFAYYSPVGPSGMNMHPQAGLSMLGSSP
DARRRFIPYSHPNGIGMSPSTGNFAPLPLGTSPSQFTPPNSYSQVSAGSPGHYGPTSPAR
SNCHGSPLGKMAAVTQFNRRKSWGYSGSSQNQESPQSSHWQGQFADGTSSSQPEGNPPIL
GSSPSHRQSNSSTASWMQQHGGGGITAGHSAIQNMPGSFKPSSMQFPQNAGPAFDKPEAS
LSLPDPGDWDPNYSDELLLQEDGSDVSSINTEFNKGMHLGSGDPSVTFGRSNRASNQSSS
SLVQRQNGPVQFAHPEAGSPPSAHDLHAGYGRSMSKPSHFMPHISQNSPSRLGQQSLPRC
NHGRPAVRGSEWNHIKVQPPQPNFSSGGPHSPGNSSINNGMPWGRRANYPVTSIPPASRG
RKDYGRIA
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagaaacagatcacagaagcaagaaaggtcgtatacattgtaaaagatgttctt
ggccatggaacatttgggcaggttgctaaatgctgggttgcagaaacaaatagttttgtt
gctgtaaagataattaaaaatcaaccagcttactatcagcaagccttggttgaagtatct
attttgaccacgttaaacaagaagtatgatcctgaagataagcatcacattgtccgaata
tatgattatttcgtatttcagaggcatttgtgcatttgctttgaactgctctacacaaat
ctgtacgagcttatcaagctaaatcagttcaggggtttatcattgagcattgtccaattg
ttctctaagcagattttacatggattggctctgttaaaagatgctgggattattcattgt
gatttgaagccggaaaacattctgctatgcacaagtgtgaagccagcagaaattaaaata
attgactttggatcagcatgcatggaggatcgtactgtttactcctatatccagagtcgt
tattacagatctcctgaagtcctccttggataccaatatactacatccattgacatgtgg
tcttttgggtgcatagtcgcagaactgtttctaggattgccactcttccctggagcttca
gaatttgatcttttgaggagaatgatcgaaatacttggtggacaaccccctgattatcta
ctaaaggaagcaaaaaatacgagcaaattcttcaagtgcattggaagtgtccacaatgta
gatcatggtgatatgtcattgggaagcaaaagtgcttaccaagcattaacagtggatgaa
tatgaagttagggagttgaagaagccatctatcggaaaggagtatttccatcataagaac
cttgaggcaattgttacaaattatccttacagaaagaatttgccacaggaagacattatg
aaagaaagtcaaatacgattagcattgattgatttcttgagagggcttgtggagtttgat
cctgcaaaaaggtggtccccttttcaggcttcaagacacccttttgtaactggggaacct
ttcacctgtccttacaagcctcctccagagagtcctcgcatgcctgttgcacaaaatttt
aaggtggaccatcacccaggtggtgggcattggtttgctgcgggtctttctcctaatatt
ccaggcaggaccagagcatcccttcataatagccctcactttcaagtggttccatatgca
catggtaatagctatggcagtataggaagccatggcagctacaatgatggtattggcctt
ggaagcagttatggaagttatggagatggcagcaatatgtttgcatattattcaccagtt
ggcccatctgggatgaacatgcacccacaggctggtctatcaatgcttggaagtagtcca
gatgcaagacggaggtttattccatactcacatccaaatggaattggtatgagtccgtca
acaggaaattttgcaccactccctcttggcaccagtccctcacaatttactccaccaaat
tcctacagtcaagtgtcagctggttctcctgggcactatggtccaacttcaccagcaaga
agcaattgtcatggatcacctttaggaaaaatggctgcagttacccaattcaatagaaga
aaaagttgggggtattctggaagttcccagaatcaagagagtccacaatcttcacattgg
caaggacagtttgctgatggaaccagttcaagccagcctgagggaaatcctccaatactt
ggaagttcaccctcacatcggcagtcaaattccagtactgcaagctggatgcagcagcat
ggaggtggtggaattactgccggtcactctgccattcagaatatgccaggctctttcaag
ccttctagcatgcaatttcctcaaaatgcaggaccggcttttgataagcccgaggctagc
ctgtcattgcctgatccaggagattgggatcctaattacagtgatgaacttcttctacaa
gaggatggttcagatgttagctccataaacactgagttcaataaaggcatgcatcttggt
tcaggcgatccatcagttactttcggaagatcaaaccgtgcgtcaaaccagagctccagt
tcattagttcaaagacaaaatggacctgtacaatttgcgcacccagaggctggcagccct
ccttcagctcatgacttgcatgctggatatggccgttcgatgtcaaagccttcacatttc
atgccacatatctcacagaactcaccaagccgtttaggacagcaatcccttccacgctgc
aatcatgggaggcctgctgttcggggtagtgaatggaatcatattaaggtccagcccccc
caacccaactttagttctgggggcccacattctccaggaaacagttcaattaataatggc
atgccatgggggcgtagggccaactatcctgtcacaagcattccaccggcatcccgaggc
agaaaagactacggaaggattgcctag

DBGET integrated database retrieval system