KEGG   Ricinus communis (castor bean): RCOM_1517510Help
Entry
RCOM_1517510      CDS       T01087                                 

Definition
delta DNA polymerase, putative
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
rcu  Ricinus communis (castor bean)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RCOM_1517510
   00240 Pyrimidine metabolism
    RCOM_1517510
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RCOM_1517510
   03410 Base excision repair
    RCOM_1517510
   03420 Nucleotide excision repair
    RCOM_1517510
   03430 Mismatch repair
    RCOM_1517510
   03440 Homologous recombination
    RCOM_1517510
DNA repair and recombination proteins [BR:rcu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      RCOM_1517510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 126 aa AA seqDB search
MATASPNDMKSFYRQKKTNKTGITKSSSKSKKKSPPKHAAAIGSNITQPTALISHGGALD
LQDDYDKNEEVLRQFDMNMAYGPCLGMTRVGRWERAQRLGLNPPKQIEDLLKGGKVNSEC
LWDGRV
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggcaacggcatcaccaaacgacatgaagagtttctacaggcaaaagaagaccaacaaa
actggcattactaaatcctcttctaaatccaagaagaaatcgccacctaaacatgccgct
gctattggctctaatattacacagccaactgccttgatttctcatggcggtgcgcttgat
cttcaagatgattatgacaaaaacgaagaagtgttgaggcaatttgacatgaacatggca
tatgggccatgccttgggatgacacgggtggggcgatgggagcgcgctcaacgtttaggt
ctgaacccacccaaacaaatcgaggatctgttgaagggtggaaaagtgaactcagaatgc
ctttgggatggccgtgtttga

DBGET integrated database retrieval system