KEGG   Ricinus communis (castor bean): RCOM_1573010Help
Entry
RCOM_1573010      CDS       T01087                                 

Definition
2-alkenal reductase, putative (EC:1.3.1.74)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
C4-dicarboxylic acid cycle, NAD - malic enzyme type
C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    RCOM_1573010
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    RCOM_1573010
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    RCOM_1573010
Enzymes [BR:rcu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     RCOM_1573010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 285 aa AA seqDB search
MGTEGAEQNGVFRVTIKKKEVVAAVLPLQEHWLSLSDLDLLHQLVEVQDCYELSAEYEGK
HNPQKLAELGKVLTSLDLGDSIVVTKSFSHMLNLANLAEEVQIAYRRRIKLKKGDFADEN
SATTESDIEETLKRLVVQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHVRIRD
CLTQLYAKGITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAGMSYFHETIWKG
VPKFLRRVDTALKNIGINERVPYNAPLIQFSSWWVEIVMVCFFVT
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgggtaccgaaggagcagaacagaatggcgttttcagggtcacgattaagaagaaggag
gtggtggcagcagtgctaccattgcaagaacattggttgtcactctccgacctagacctg
cttcatcaacttgttgaagttcaagactgttatgaactttcagctgagtatgaagggaaa
cacaaccctcaaaagttggcggaacttgggaaagtgctaacaagtttggatcttggggat
tcaattgttgttacgaagtcattctctcacatgcttaacttggccaatctggctgaggaa
gttcagatcgcttatagacgaagaatcaaattgaagaaaggagattttgctgatgagaac
tcagcaacaactgaatcagacattgaagagaccctaaaaagactggtggtgcaattgaag
aaatccccagaagaagtttttgatgctttgaagaaccagactgtggatttagtcttaact
gcacatcctactcaatctgttagaagatctttgcttcaaaagcacgtaaggatacgggac
tgtttgactcagttgtacgctaagggcattactccagatgataagcaggaacttgatgag
gccttacaaagagagattcaagctgcattccgcacagatgaaatccgaaggactcctccg
actccacaagatgagatgagagcaggaatgagctacttccatgagactatatggaagggt
gtcccgaagttcttgcgccgtgttgacacagctttgaagaatattgggataaatgagcga
gttccttataatgctcctctcatccaattctcctcttggtgggtggagatcgtgatggtg
tgtttctttgttacataa

DBGET integrated database retrieval system