KEGG   Ricinus communis (castor bean): RCOM_1573230Help
Entry
RCOM_1573230      CDS       T01087                                 

Definition
transcription cofactor, putative
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     RCOM_1573230
Transcription factors [BR:rcu03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    RCOM_1573230
Mitochondrial biogenesis [BR:rcu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    RCOM_1573230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1720 aa AA seqDB search
MNVQTHMSGQISGQVPNQLPQQNGNPQLQNLGTAGSGGPAPPNMFSMDPELHRARIYMRE
KIFAIILQRQPQPVSEPQKQKFKDIAKRLEEGLFKAAQTKEDYMNLNTLESRLSSLIKRT
PVNNHNQRHVQLVNPSSSIGTMIPTPGIPHGGNSNLMVSSVDSMMIASSGCDSIAATTVN
TGSLLSASGIHSGSFSRSDGVLPNGYQQSPASFSINSSGNMSSLGVQRMTSQMIPTPGFN
SNNNNNSNNSITSNQSYVNMESSTNNVSGYSTVESTMVSQPLQQKQYVSGQNSRILQNLG
SQLGSNIRSGLQQKSYGFPNGALNGGMGMIGNNLQLVNEPCTSEGYVTSTPYASSPKPLQ
QHFDQQQRQLIQGDGYGMSNADTFGSGNFYGALTSVGSVMNSQNMTSVNLQPMSKSNSSL
VNNQSNLQDSVLQTHQQQQFQQHLHQFPQQQFIQQHSLQKQQNQQHPLLHDTFDQSQLAS
DPSSQVKLEPGMEHHNENLHSQTPQHFQISELQSQFQQNVVEDRPRGAQNLSLPSGQNEM
CSSLAQNSQQMQQILHPHQLVSESQSDFDCLAVGTPSDSVLQSQWHPNLQGRTGIPRSML
HDQHVQEDFRQRIYGQDEAQRNNLASEGSFIGQNVPPRSTSESQNSNGVTCRSGNANPDR
QFRNQQRWLLFLRHARRCTAPEGKCPETNCINAQKLLRHMDKCNTSPCPYPRCHHTRILI
RHNKHCRDVGCPVCIPVKNYIEAQMRPRTRPVSDPGLSSKPNDIGDNTAKLISKYPSVET
SEELHPSLKRMKIEQSSRSLKPESESSAVSASVTADSLVSQDAQHQDYKQGDTTMPVKSE
YMEVKLEGPISSGQGSPSKNEKKKDNMDDTNSQRPDGESVARDESTSLAKQEKIKIEKEV
DPVKQENSAQPADSATGTKSGKPKIKGVSLTELFTPEQVREHITGLRQWVGQSKAKAEKN
QAMEHSMSENSCQLCAVEKLTFEPPPIYCTPCGARIKRNAMYYTMGAGDTRHYFCIPCYN
EARGDSILADGTPIQKARLEKKKNDEETEEWWVQCDKCEAWQHQICALFNGRRNDGGQAE
YTCPNCYIAEVERGERKPLPQSAVLGAKDLPRTILSDHIEQRLFRRLKQERQERARVQGK
TYDEVAGAESLVIRVVSSVDKKLEVKQRFLEIFREENYPTEFPYKSKVVLLFQKIEGVEV
CLFGMYVQEFGSESQFPNQRRVYLSYLDSVKYFRPEIKTVTGEALRTFVYHEILIGYLEY
CKKRGFTSCYIWACPPLKGEDYILYCHPEIQKTPKSDKLREWYLSMLRKASKENIVVDLT
NLYDHFFVSTGECKAKVTAARLPYFDGDYWPGAAEDLIYQLNQEEDGRKQNKKGTTKKTI
TKRALKASGQSDLSGNASKDLLLMHKLGETICPMKEDFIMVHLQHCCTHCCILMVSGNRW
VCNQCKNFQICDKCYESEQKREERERHPVNQREKHALYPVEITDVPADTKDKDEILESEF
FDTRQAFLSLCQGNHYQYDTLRRAKHSSMMVLYHLHNPTAPAFVTTCNICHLDIETGQGW
RCEVCPDYDVCNACYQKDGGIDHPHKLTNHPSTADRDAQNKEARQQRVLQLRRMLDLLVH
ASQCRSPHCQYPNCRKVKGLFRHGIQCKTRASGGCVLCKKMWYLLQLHARACKESECHVP
RCRDLKEHLRRLQQQSDSRRRAAVMEMMRQRAAEVAGNSG
NT seq 5163 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgcagacacatatgtctgggcagatctcagggcaggttcctaatcaactgccc
caacaaaatgggaatccccagttgcagaatttaggtactgctggcagtgggggtcctgct
ccgcctaatatgttctccatggaccctgagcttcatagagctcgcatttatatgcgagag
aaaatatttgctattatattgcagcggcagcctcagccagtcagcgaaccacaaaaacag
aaattcaaggatattgccaaacgcttagaggagggtctatttaaagctgctcagacaaag
gaggactatatgaacctaaataccttagagagccgtcttagtagtttgatcaagcgcaca
cctgtgaataaccacaatcaacgacatgtgcaacttgttaatccttcctcttccattggc
actatgataccaacccctggtataccacatggtgggaattccaacttgatggtatcttct
gtagattccatgatgattgcttccagcggatgtgatagtatagcagctacaacagtgaac
acaggtagcctgttgtctgctagtggtatacacagtggttcctttagtagatctgatgga
gttctacctaatggttatcagcagtcaccagccagtttttccattaactctagtggaaat
atgtcatccttgggtgtgcagagaatgactagccagatgattccaactcctggatttaat
agcaataacaacaataatagtaacaatagcattactagtaaccaatcttatgtgaatatg
gagtcttctactaataatgtcagtggttattcaactgttgaatcaacgatggtatcacag
cccctgcagcaaaagcagtatgtcagtggtcaaaatagtcgcatattgcagaatcttggc
agccaattgggaagcaatatcagatctggcttgcagcagaaatcttatgggttcccaaat
ggtgctttaaatggcggaatggggatgattgggaacaatttacagcttgtgaatgaaccc
tgtacctctgaggggtatgtgacttccacaccttatgctagttctcccaaaccattgcag
cagcactttgatcaacaacagagacaactaatccagggtgatgggtatggaatgagtaat
gctgatacttttggttctggaaacttctatggcgctctaacatctgttggatcagtgatg
aattctcaaaatatgacctctgtgaacttgcagcctatgtccaaatctaattcgtctctg
gtaaataatcaatcaaatttacaagacagtgtgttacaaactcaccaacagcagcaattt
cagcaacatcttcatcaattcccacagcaacaattcattcagcaacatagcctacaaaag
cagcaaaaccagcagcaccctctgttgcatgatacttttgatcagtctcagctggcatct
gatcctagtagccaggttaagcttgagcctgggatggagcatcacaatgaaaatctccac
tcacaaacccctcaacatttccaaatatctgagctacaaagtcaattccagcagaatgtt
gttgaagaccgtccccggggtgcacaaaatctctctcttccatctgggcagaatgaaatg
tgttcgtcactggcacaaaattcgcagcaaatgcaacagatattacatccacatcaattg
gtttcagagtctcaaagtgattttgattgccttgctgttgggacaccatcagattcagta
ttgcagagtcaatggcatcctaatttgcaaggcagaactggcatacctaggagcatgttg
catgatcagcatgtccaggaggacttccgtcaaagaatatatggtcaggatgaagctcaa
cgtaataatttagcttcagaaggatcatttattggtcagaatgttcctcctagaagcaca
tccgagagccaaaactcaaatggtgttacatgtagatctggaaatgcaaatcctgaccga
cagttcagaaatcaacagaggtggcttctgtttttgcggcatgctcgtaggtgtacagcc
ccagaagggaaatgtccagaaactaattgcattaatgcccaaaaactgttgagacatatg
gataaatgtaacacatctccatgcccatatcctcgatgccatcataccaggatattgatt
cgacacaacaagcactgcagagatgtaggttgccctgtctgtattcctgtcaaaaattat
atagaggcgcaaatgaggccacgcactcgtccagtctcagatcctggtttatcaagcaaa
cctaatgatattggtgataatactgctaagttgatttcgaaatatccatcagttgaaact
tccgaagagctacatccttctttaaagcgcatgaagatagagcagtcctcccgctctctt
aaacctgagagtgaaagttctgctgtgtctgcttctgtaaccgctgattcccttgtgtcc
caggatgcccagcaccaagattacaaacagggtgatacaactatgccagttaagtctgag
tacatggaagtgaaactggaaggtccaataagttctggacaaggaagtcctagtaaaaat
gagaagaaaaaggataatatggatgatacaaacagccaaaggcctgatggtgaatctgtt
gcaagggatgagtcaaccagtttagctaagcaagagaagattaaaattgagaaagaagtt
gatcccgtcaagcaagaaaattctgcacaacctgctgatagtgctactggaaccaagtct
gggaagccaaagataaagggagtatcgttgactgaactgttcactccagaacaagttagg
gagcatattacaggccttagacaatgggttggccagagtaaggcgaaggcagaaaagaac
caagcaatggagcattcaatgagtgagaactcttgtcagttgtgtgcagttgaaaagctg
acttttgagccaccacctatatattgcacaccttgtggtgctcgcattaagcgaaatgca
atgtattatactatgggagctggtgatacacggcactacttctgtattccgtgttataat
gaggctcgtggagactctatccttgctgatgggactcctattcaaaaggcaaggcttgag
aagaagaaaaatgacgaggagactgaagaatggtgggttcaatgtgacaaatgtgaagca
tggcaacatcaaatctgcgctttatttaatggtcgaagaaatgatggtggacaagccgaa
tatacttgccctaattgctacatagcagaggttgaaagaggagagcgtaagcccttaccg
cagagtgcagttcttggggccaaagatctaccaagaacaatacttagtgaccacatagag
caaagattgttcaggagactgaaacaggaaagacaggagagggctagggttcaaggaaaa
acttatgatgaggttgctggagcagaatcacttgtgattcgagtcgtttcatcagtcgac
aagaaattggaagtgaagcagcggttccttgaaatttttcgagaagagaattatccaact
gagttcccttataagtccaaggtagttttgttgtttcagaagattgaaggtgtggaggta
tgcttatttggcatgtacgttcaagaatttggatcagaaagtcaatttccaaatcagcgg
cgtgtctatttgtcctacctggattctgtgaagtatttcagacctgagattaaaacagtg
acaggggaggctctgcgtacatttgtttaccatgaaattttgattggataccttgaatat
tgcaagaagagaggttttacaagctgctatatatgggcttgccctccattaaagggtgaa
gactatattttatattgtcatccagaaatacagaaaacaccaaaatctgataaactccgc
gaatggtatttgtcgatgttgaggaaagcctcaaaggaaaatattgtggttgacctaact
aatttatatgatcatttcttcgtatctactggtgaatgcaaagcaaaggtaacagcagct
aggctaccatactttgatggtgactattggcctggtgctgcagaggatttaatttatcag
cttaaccaagaagaagatggtagaaagcagaacaagaaaggaactacaaaaaaaaccata
acaaaaagggctttaaaagcatctggtcagtcagatctttctggtaacgcgtcgaaggat
ttgttactgatgcataagcttggtgagacaatttgcccgatgaaggaggactttatcatg
gttcatttacagcattgctgcacgcattgttgtattttaatggtgtctggaaaccgttgg
gtttgcaaccagtgcaaaaattttcagatttgtgataaatgttacgaatctgaacagaaa
cgtgaagaaagagagcgacatcctgtcaaccaaagggagaaacatgcactctatccagtt
gaaattactgatgtacctgctgatacaaaagataaagatgaaattcttgagagtgaattt
tttgacacaagacaagcatttttgagtctatgccaagggaatcattatcagtatgatact
ttacgccgggccaagcattcctcaatgatggtcctttaccatctccataatccaactgct
cctgcttttgtaacaacatgcaatatatgtcatcttgatattgaaaccggtcaaggttgg
cgctgtgaagtttgccctgactatgatgtatgcaatgcttgttatcaaaaagatgggggg
attgatcatcctcataagttaactaatcatccatctacggctgatcgtgatgcccagaat
aaagaagctaggcaacaaagggttttgcagctaaggagaatgcttgatcttctggtgcat
gcttcacaatgtcgatctccacattgccaatatccaaattgtcgtaaggtgaaagggctt
ttccggcacgggatacaatgcaagacacgtgcatctggaggttgtgttctgtgtaagaaa
atgtggtatctcctgcaacttcatgctcgagcatgcaaggaatctgaatgccacgtacca
cgttgcagggatctgaaagaacatttgagaaggctgcagcagcagtctgattcacgacga
agggctgcagtgatggagatgatgagacagagagctgcagaggttgctggtaattctgga
taa

DBGET integrated database retrieval system