KEGG   Ricinus communis (castor bean): RCOM_1573850Help
Entry
RCOM_1573850      CDS       T01087                                 

Definition
7-dehydrocholesterol reductase, putative (EC:1.3.1.21)
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Steroid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    RCOM_1573850
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     RCOM_1573850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 560 aa AA seqDB search
MGEEKTVHSALVTYASMLSLLTFCPPFVILLWYTMVHADGSVSQTWDFFKQQGLQGFINI
WPRPTATAWKIIACYAAFEAALQLLLPGKRVEGPISPQGNRPIYKANGVAAYIVTLVTYL
GLWWFGIFNPTIVYDHLGEIFSALIFGSFFFCVYLYIKGHLAPSSTDSGSCGNIIMDFYW
GMELYPRIGKNFDIKVFTNCRFGMMSWAVLALTYCIKQYEQNGKVADSMLVNTILMLVYV
TKFFWWEAGYWNTMDIAHDRAGFYICWGCLVWVPSVYTSPGMYLVNHPLNLGTQLAVYIL
VAGILCIFVNYDCDRQRQEFRRKNGKCLVWGKAPSKIVASYTTTSGETKTSLLLTSGWWG
LSRHFHYVPEILAAFFWTVPALFNHFLPYFYVTFLTILLFDRAKRDDDRCRSKYGKYWKL
YCEKMSAYENVVGGKLKLKGKALNVKAGGMKKKKKHKQHQDEVSQVVNKELLEGQSTEEL
AAPSEDGVNESDKLGEEGKTASYDDYMTPAERRYMEQREKIDIHRMAKEANKSHRDRIQD
FNQYLANMSEHYDIPKVGPG
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagagaagacagtgcattcagcattggtgacttatgcttcaatgctttcgctt
ctcactttctgccctccctttgttattttgctatggtacacaatggtgcatgctgatgga
tcagtttctcaaacttgggatttcttcaagcaacaagggttgcagggatttattaacatt
tggccaagacccactgctacagcttggaaaataattgcttgttatgctgcatttgaggct
gcacttcagcttcttttacctggcaaaagggtggagggccctatttcacctcaagggaac
cgaccgatatacaaggcaaatggtgtggcagcatatatagtaacgctggttacctatctg
ggcctttggtggtttgggatattcaaccccacaatagtttatgatcatttgggagagata
ttttcagctctcatctttggaagcttcttcttctgtgtttatttgtacataaaaggtcat
ttggcaccatcatcaacagattctggttcatgtggaaacataataatggatttctattgg
ggcatggagctgtatcctcgaattggaaagaactttgacatcaaagttttcacaaattgc
agatttgggatgatgtcttgggcagttcttgcattgacctactgcattaagcagtatgag
cagaatggaaaagtggcagattccatgcttgtaaatacaatattgatgttggtgtatgtt
acaaagtttttttggtgggaagctgggtactggaatacaatggatatcgcgcatgatcga
gctgggttttatatttgctggggatgcttggtatgggttccatccgtatatacttctcct
ggcatgtacctagtcaaccatcctttaaaccttggaactcagcttgcagtttacatcttg
gtggcaggcattctctgcatatttgtcaactatgattgtgacaggcaaaggcaagaattt
cggagaaaaaatggcaaatgcttggtttggggaaaggctccatcaaaaattgtggcttca
tacactacaacatctggggaaacaaaaaccagccttcttttaacctctggatggtggggc
ttatctcgtcatttccattatgtacctgaaatattagctgcttttttctggactgtccca
gctctatttaatcattttctaccctacttctatgtgacatttcttaccatccttcttttt
gatcgagctaaaagggatgatgatcgatgcagatccaagtatggaaagtactggaagttg
tactgcgagaagatgtcagcatatgagaatgtcgttggtggaaagctgaagctgaagggg
aaagccttgaatgtgaaggctggtgggatgaagaagaaaaagaaacataagcagcaccaa
gatgaagtttctcaagtcgtcaacaaagagcttttagaaggtcaaagcacagaagaatta
gctgcacctagtgaggatggtgtaaatgaaagtgacaaattgggtgaagaagggaagact
gcttcttatgatgattatatgacacctgcggagagacgatacatggagcaaagagagaag
attgatattcataggatggcgaaggaagctaataaatctcaccgtgacaggattcaagat
ttcaaccagtacttggccaatatgagtgagcattatgacattcctaaagttggtcctggc
tga

DBGET integrated database retrieval system