KEGG   Ricinus communis (castor bean): RCOM_1578810Help
Entry
RCOM_1578810      CDS       T01087                                 

Definition
Magnesium-chelatase subunit chlD, chloroplast precursor, putative (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCOM_1578810
Enzymes [BR:rcu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     RCOM_1578810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 760 aa AA seqDB search
MAFSPTAGTKFTLPYGVPTSLSQLQSSVLSIPCFKSHSHSFKSPKRRPYSYRRFGVIVSS
SATPTLQSTNGAVVSPSQNPDSSSYGRQYFPLAAVVGQDAIKTALLLGAIDREIGGIAIS
GKRGTAKTVMARGLHAILPPIDVVVGSIANADPSCPEEWEDGLAERVEYDSDGNIKTEVV
RSPFVQIPLGVTEDRLIGSVDVEESVKTGTTVFQPGLLAEAHRGVLYVDEINLLDEGISN
LLLNVLTEGVNIVEREGISFRHPCKPLLIATYNPEEGAVREHLLDRIAINLSADLPMNFE
DRVAAVGIATQFQEHCTEVFKMVEEETEFAKTQIILAREYLKDVTVSRDQLKYLVLEALR
GGCQGHRAELYAARVAKCLAALEGREKVNVDDLKKAVELVILPRSIINESPPEQQNQQPP
PPPPPQNQDPGDEQNEEEDQEDNDEDNEQQQDQIPEEFIFDAEGGFVDEKLLFFAQQAQR
RRGKAGRAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLRREKDTQKSRKV
FVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAAIKLLAESYTSRDQVAIIP
FRGDSAEVLLPPSRSIAMARKRLERLPCGGGSPLAHGLTTAVRVGLNAEKSGDVGRIMIV
AITDGRANISLKRSTDPDVAASDAPRPSAQELKDEILEVAGKIYKAGMSLLVIDTENKFV
STGFAKEIARVAQGKYYYLPNASDAVISATTKEALSALKS
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctctcctactgctggaactaagtttactttaccatatggcgttccaacttca
ctctcccagctccaatcctcagtgcttagtattccttgtttcaaatcacattcccactcc
ttcaagtctccaaaacgacgaccttacagttatcgtcgttttggcgttattgtttcttct
tctgcaactccaactctacagtctacaaacggcgccgttgtgtctccctctcagaaccca
gactcttcttcctatggaaggcagtacttccctttagccgctgttgttggccaggatgct
ataaaaactgctctgttgcttggggctattgatcgtgagattggaggaattgctatttct
ggaaagcgaggaacagccaagacagttatggcacgtggattgcatgccattttgccacca
attgatgttgttgttggttctatagctaatgctgatccatcctgccctgaagagtgggaa
gacggcttagcagaacgagtggaatatgattctgatgggaatattaagactgaagttgtt
aggtctccttttgttcagattcctttgggagtcacagaggatagacttattggttctgtt
gatgttgaggagtctgtgaaaacaggaactactgtctttcagccaggccttctagctgaa
gctcatagaggtgttctgtatgttgatgagattaatcttttggatgagggtattagtaat
ttgcttcttaatgttttgacggaaggggttaatattgtcgaaagagagggaatcagcttt
aggcatccatgcaagccacttctgatagctacttacaacccagaagagggtgctgttcgt
gaacacttactggatcgtattgctattaatttgagcgcagatcttccaatgaattttgaa
gatcgtgtagcagctgttggtattgcgacacagtttcaggaacattgtactgaagttttt
aaaatggtcgaggaagagacagaatttgcaaagacccagatcattttggctagagagtat
ttgaaggatgttaccgttagcagggaccaattgaagtatcttgttttggaagcccttcga
ggtggttgccagggacacagagcggagctatatgctgctcgtgttgcaaaatgcttggct
gctcttgaaggacgtgaaaaagtcaatgtggatgacctgaaaaaagctgtggaattggtt
attcttcctcgttcaatcatcaatgagagtccaccagaacagcaaaaccaacagcctcca
cctccaccacctccacaaaatcaggatcctggggatgagcagaatgaggaggaagaccaa
gaggacaatgatgaagataatgaacaacagcaggatcaaatacctgaagaatttatattt
gatgcagaagggggctttgtagatgaaaaacttctattctttgcacaacaagcgcagaga
cggcgaggcaaggctgggagagcaaagaacgtcatattttcagaggacagaggtcgctac
attaaaccaatgctccctaagggtcctgtgaagagattagcagttgatgcaacccttagg
gcagctgcaccatatcaaaaactgcgtagagagaaggacactcaaaagagtaggaaagtt
tttgttgagaaaactgatatgagggcaaaaagaatggccagaaaagccggagcactggtg
atatttgtagtcgatgcaagtggaagtatggcgttgaaccgaatgcaaaatgcaaaaggt
gctgcaattaagttactagctgagagttatacaagcagggatcaggttgctattatcccc
ttccgcggagattctgctgaagttcttttacctccttccagatcaattgcaatggcaaga
aaacgccttgaaagacttccatgtggtggtggttcgcccttagctcacggcctcacaact
gctgttagggttgggttaaatgcagaaaagagtggtgatgtagggcgtataatgattgtt
gctataacagatggtagagccaacatatcactgaaaaggtccactgatcctgacgttgct
gcttctgatgccccaagaccttcagcacaagaattgaaggatgagattcttgaagtggcg
gggaaaatatacaaggcaggaatgtcccttcttgtcattgatacagaaaacaagtttgtc
tcaactggatttgctaaagagattgcaagagtcgctcaaggaaaatattattacttgccc
aatgcttcagatgctgttatttctgctacgactaaagaagctttatcagccttaaagagt
taa

DBGET integrated database retrieval system