KEGG   Ricinus communis (castor bean): RCOM_1591750Help
Entry
RCOM_1591750      CDS       T01087                                 

Definition
methylcobalamin:com methyltransferase, putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCOM_1591750
Enzymes [BR:rcu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     RCOM_1591750
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 126 aa AA seqDB search
MEIVVHVYADTSFDWIVITSPEAGSVFLEAWKAAGTPNIKVGVVGAGTASIFNEVKQTSG
QSLDIAFVPSKATGKVLASELPKSESKRCTVLYPASAKASNEIEEGLSNRGFEVVRLNTY
TTSSSV
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggagattgttgtgcatgtttatgcagatacttcctttgactggattgtcataacctcc
cctgaagcgggttcggtctttctggaggcatggaaggccgctggaaccccgaatattaag
gtaggggttgttggagctggtacagcaagcatttttaatgaagtaaagcaaacatctgga
caatctcttgatattgcctttgtgccatctaaagctacaggtaaggttttggcatcagag
cttccaaagagtgagagcaaaagatgcaccgtgttgtatccagcttctgctaaagcaagt
aatgaaattgaggaaggtctctctaatcgcggatttgaggttgtgaggctaaatacatat
acaacatcttcttctgtctaa

DBGET integrated database retrieval system