KEGG   Ricinus communis (castor bean): RCOM_1595070Help
Entry
RCOM_1595070      CDS       T01087                                 

Definition
cinnamoyl-CoA reductase, putative (EC:1.1.1.219)
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:rcu00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 347 aa AA seqDB search
MGSEVQTVCVTGASGFIGSWLVMRLLERGFMVRATVRDADNMKKVKHLLELPNAKTHMTL
WKADLAQEGSFDDAIRGCSGVFHVATPMDFEPKDPENEVIRPTVNGVLDIMKACAKAKTV
RRIVFTSSAGTVDVEEHRKEMYDEHCWSDLDFILTKKMTGWVYFVSKSLAEKAAWKFAEK
NNLDFISIIPTLVVGPFLGSFFPPSLITALAPITGNEAHYSIIKQGHFVHLDDLCNAHIF
LFEHPKAEGRYICSSHDATIHEVAKLLREKYPEYNIPAKINGVEEDIKNFIFSSKKLTDM
GFQFKYSLEDMLVGGVESCRAKGVLPVPNVKELADGGKQNGCDYSCI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggatcggaagtacaaaccgtttgtgtcacgggtgcttctggcttcatcgggtcatgg
cttgtaatgagacttcttgagcgtggttttatggttcgagccaccgtgcgcgacgctgat
aatatgaagaaagtgaagcatttgttagaattgccaaatgctaagacccacatgacctta
tggaaagctgaccttgcccaagaaggaagttttgatgatgcaattcgagggtgcagtggt
gttttccatgtggctacccccatggattttgaacccaaggatcctgagaatgaagtgata
agaccaacggtcaatggtgtattagacataatgaaggcatgtgccaaggcaaaaactgta
cgaagaatagtatttacatcttctgcgggaactgtagacgttgaggaacacaggaaagaa
atgtacgatgagcactgctggagtgatcttgatttcattctgacaaaaaagatgactgga
tgggtatatttcgtctccaagtctctggcagagaaggccgcctggaagtttgctgaaaag
aataatcttgattttattagcatcatccctactctagttgttggtccatttctcggatca
ttttttccacctagccttattactgcacttgccccgattaccggaaatgaagctcattat
tcgattataaagcaagggcattttgtgcatttagatgatctctgcaatgctcacatattt
ctgtttgagcatccaaaagctgagggccgttacatttgctcctcgcatgatgccaccatt
catgaggtcgcaaaattgcttagagaaaaatatccggagtacaatattcctgcaaagata
aatggagttgaagaggatattaagaacttcatcttctcatccaaaaagcttacggacatg
ggtttccagttcaagtatagcttggaagatatgttggtaggaggtgtggaatcatgtaga
gcaaagggagtgcttcctgtccccaatgtaaaagaattagccgatggaggcaaacaaaat
ggatgtgactattcctgcatctaa

DBGET integrated database retrieval system