KEGG   Ricinus communis (castor bean): RCOM_1595270Help
Entry
RCOM_1595270      CDS       T01087                                 

Definition
bifunctional dihydrofolate reductase-thymidylate synthase, putative (EC:1.5.1.3 2.1.1.45)
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:rcu00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rcu00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:rcu00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 591 aa AA seqDB search
MYGKIRLAFRRYLDFDAAMLTRVLLSSCKNSFWNSSYLSVAVTRLQIVSCESPKWRSYRR
LSVMSGDVSIGIPRGNANMHLDRNRRYQVVVAATRDMGIGKDGKLPWRLPSDLKFFKELT
LTTSSPGKRNAVVMGRKTWESIPLKYRPLPGRLNIVLTCSGGCDITTAEDVLTCGSIPSA
LELLAEAPYSFLIEKVFFIGGGQILRKTINAPGCDAIHITEIETSIECDTFIPVIDFSLF
HPWYSSLPIVENNVRYSFATYVRVKNSENGTLSKSASANGNLSSNTFEVKNFTFLPSIIY
KKHDEYMYLRLAEQIISNGTLKDDRTGTGTLSKFGGQMQYNLRKSFPLLTTKRVFWMGVV
EELLWFISGSTNAKVLQEKGIHIWDGNASRDYLDSIGLKDIEESDLGPIYGFQWRYFGAR
YTDMHADYSGQGFDQLVDVIDKIKSKPDDRCIILRSWNPSDLKLMAFPPCHMFAQFYVAN
GELSCQMYQRSADIGLGVPFNIAFYALLTCIIAHVCALVPGDFIHLIGDARVCTTHIGPL
QKQLQKLPTPFPILRINPAKKDIDSFEASDFQLIGYDPHEYIDMKNLSVDL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaagatccggcttgctttcagaagatatctagattttgatgcagctatgctc
acccgagttttattgagttcttgtaagaatagcttctggaattcttcttatctatctgta
gcagtcacccgactacagatagtatcttgtgaatctccaaagtggagatcttacagaaga
ttatctgttatgagtggcgacgtttcaataggcattcctagaggcaatgccaatatgcat
cttgatcgaaataggagatatcaagttgtggttgctgctactcgtgatatggggattggg
aaggatgggaagttaccatggagattgccatctgatcttaagtttttcaaggagcttaca
ttgactacatcaagtcctggaaaaaggaatgcagttgtgatgggtaggaaaacatgggaa
agtattcccttgaagtacagacccctacctggacgcttgaatattgtgctgacttgttct
gggggttgtgatatcacaactgcagaagatgttttaacatgtggaagtattccatcagca
ttggagttattggcagaagcaccttacagttttttaattgagaaggttttttttatcggc
ggtggccagatattgaggaaaacaattaatgcaccaggatgtgatgctatccacatcact
gaaattgagacaagcattgaatgtgacaccttcattccagttattgatttttctttattt
cacccatggtattcctctctaccaatagtggaaaacaatgtccgatattcttttgcgaca
tatgttcgtgttaagaattcagaaaatggtactctttctaaaagcgcttcagcaaatggc
aatttaagttccaacacgtttgaagtaaagaattttacctttcttccaagtatcatttat
aagaaacatgatgaatatatgtatctaagactggctgaacaaattatctcaaatggcacc
ttgaaagatgacaggacaggcactggtaccctatcaaaatttggtggtcagatgcagtac
aatctgcgcaaatcttttccgcttcttacaacaaagagagtgttttggatgggagttgtt
gaagaacttttgtggtttattagtggttcaaccaatgcaaaggttctacaagagaaaggc
attcatatatgggacggtaatgcatccagagactaccttgacagtattggcctgaaagat
atagaagagagtgacctgggacccatatatggcttccagtggagatactttggcgctaga
tatacagatatgcatgctgactactctggccaaggatttgatcagctggtagacgttatt
gataagatcaagagtaaaccagatgacaggtgtattatcctcagatcatggaatccatca
gatcttaaattgatggcgtttccaccttgtcacatgtttgcacagttctatgtggctaat
ggggagctgtcttgtcaaatgtaccagcgatctgctgatatcggtcttggagtgccattt
aacattgccttttatgctttattgacatgcataattgcccatgtttgtgctcttgttcct
ggtgattttatccatttgattggggatgctcgtgtttgtacaactcatattgggcctttg
cagaagcagcttcagaaacttcctacacctttccctattctgaggataaatcctgcgaaa
aaggatattgattcatttgaggcatctgactttcaactcataggctatgatcctcatgag
tatatagatatgaaaaatctcagtgtagatctttaa

DBGET integrated database retrieval system