KEGG   Ricinus communis (castor bean): RCOM_1595540Help
Entry
RCOM_1595540      CDS       T01087                                 

Definition
big map kinase/bmk, putative (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
rcu  Ricinus communis (castor bean)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 372 aa AA seqDB search
MATPVEPPNGVSIHGKHYYSMWQTLFEIDTKYVPIKPIGRGAYGIVCSSVNRETNEKVAI
KKIHNAFENRVDALRTLRELKLLRHLRHDNVIQLRDVMMPIHRRSFKDVYLVYELMDTDL
HQIIKSSQALSNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLA
RTSNGKGQFMTEYVVTRWYRAPELLLCCDYYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIINILGSQREEDLEFIDNPKAKKYIKSLPYSPGTPFSRLYPNAHPLAIDLLLKML
VFDPSKRITVTEALQHPYMSPLFDPSSNPPAQVPIDLDIDEDLGEEMIREMMWKEILHYH
PEAATATGLICA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggctactcctgttgaacctccaaatggggttagtattcatgggaaacattactattcc
atgtggcaaactttgtttgaaattgatacgaaatatgtaccaatcaagccaattggcaga
ggagcctatggaattgtgtgttcttctgtgaatagagaaacgaacgagaaagttgcaatt
aagaaaatacacaatgcttttgagaatcgtgttgatgcactcagaaccttacgtgaattg
aagcttcttcggcatctcagacatgataatgttattcaattgagggacgttatgatgcct
atccataggagaagtttcaaggatgtttatcttgtttatgaactcatggacactgatctg
catcaaattattaagtcttctcaagcacttagtaatgatcactgccaatatttcttattc
cagttactccgtggtcttaagtatcttcactcagcaaacattctccatcgtgacttgaag
cctgggaatctccttatcaacgctaactgtgatttaaaaatttgtgattttgggcttgca
cgtactagcaatggcaagggccagttcatgactgagtatgttgttactcgttggtatcgg
gctccagaactactactctgctgtgattactatgggacatccattgatgtctggtctgtt
ggatgtatctttgcagagctgcttggccggaagcctatcttccccggaacagagtgtctt
aaccagcttaaacttatcatcaacatccttggcagccagagggaggaggatcttgaattt
attgacaaccctaaggccaagaaatacatcaagtctcttccatattcccctggcactccc
ttttctcgcctttatcctaatgctcatcccttggcaattgatttactgttgaaaatgctt
gtttttgatccatcaaagagaataactgttactgaagcactccaacatccttacatgtcc
ccactgtttgatcccagcagcaatcctccagcccaagtcccaattgatcttgacatagat
gaggatttaggggaagagatgataagggagatgatgtggaaggagatcctccattaccat
cccgaagcagctacagccactgggctgatctgtgcttga

DBGET integrated database retrieval system