KEGG   Ricinus communis (castor bean): RCOM_1600980Help
Entry
RCOM_1600980      CDS       T01087                                 

Definition
starch branching enzyme II, putative (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RCOM_1600980
Enzymes [BR:rcu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     RCOM_1600980
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   RCOM_1600980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 914 aa AA seqDB search
MTWRNNISYISDLVTVGKHKRLQQSIIENKLGGREKSHEAEWLNLEKKMLGSLTLFPAPV
FGSLANNSKRAFGNDCHITRQKPLGLIHRSQYLLGCPKVYFLSRFPVNKTVQHVLTASAV
MTDDSSTKTNIDEDMENIGLLSTDPGLDQFKDHFRYRVKRFIDQKQLIEKHEGGLEEFSK
GYQKFGFNREDGSIVYREWAPAAQEAQVIGDFNGWNGSNHRMEKNEFGVWSIRIPDSAGN
PAIPHNSRVKFRFKHGNGAWVDRIPAWIRYATVDPSSFGAPYDGVYWDPPASERYQFKYP
RPPKPRAPRIYEAHVGMSSSEPRVNSYREFADDVLPHIQANNYNTVQLMAVMEHSYYGSF
GYHVTNFFAVSSRSGTPEDLKYLIDKAHSLGLRVLMDVVHSHASNNVTDGLNGFDVGQSS
QDSYFHTADRGYHKLWDSRLFNYANWEVLRFLLSNLRWWLEEYKFDGFRFDGVTSMLYHH
HGINMGFSGNYIEYFSEATDVDAVVYLMLANSLIHNLLPDATVIAEDVSGMPGLSCSVSE
GGIGFDYRLAMAIPDKWIDYLKNKTDEEWSMGDISWSLTNRRYTEKCVAYAESHDQAIVG
DKTIAFLLMDTEMYSGMSCLTDAPPTVERGIALHKMIHLLTMALGGEGYLNFMGNEFGHP
EWIDFPREGNGWSYDKCRRQWNLVDTEHLRYKFMNAFDKAMNLLDEKHSFLSSTKQIVSS
TNEEDKAIVFERGDLVFVFNFHPENTYDGYKVGCDLPGKYKVALDSDAWEFGGQGRVGHD
VDHFTSPEGIPGVPETNFNNRPNSFKVLSPPQTCVAYYRVQESQESNNSINPGARNEIST
ADDVPKLRDIEVGMKQTLAADTGAKRGDLEEVVNQTLASDAATMLEVFKEPADDKDTEEP
TVSVKKGNSKAQEI
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgacgtggcgtaacaatataagctatatctcagatcttgtaacagttggaaaacataaa
cggctacagcagagcataattgagaataagcttggagggagagagaagagtcatgaggca
gagtggctaaatttggagaagaagatgttaggttctttaacactttttccggctcctgtt
tttggttctttagctaacaactctaaaagggctttcggaaacgattgccatattaccaga
caaaagccgcttggactgattcataggtctcaatatttgcttggttgtcccaaagtctat
ttcctctcaagattcccagtaaataagacggtacagcatgtcctcactgcctcagcagtt
atgacagatgacagctcaacaaagacaaatattgatgaagacatggaaaatattggtctt
ttgagcactgatcctggtctggatcaatttaaagatcacttcagatatagagtgaaaaga
tttatagatcaaaaacagctaattgaaaagcatgaaggaggtcttgaggaattttcaaaa
ggttaccagaaatttggatttaatagagaagatggcagcattgtctaccgtgagtgggcc
cctgcagctcaggaagcacaagttattggggacttcaatggatggaatggttctaaccac
aggatggaaaagaatgaatttggtgtttggagtatcagaatacctgattctgctggaaat
ccagcaattcctcacaattcaagggtcaaattccgattcaagcatggcaatggagcttgg
gttgatcgaattccagcttggattagatatgctactgtggacccctcaagttttggagca
ccatatgatggtgtctactgggatcctcctgcttcagaaaggtatcagtttaagtaccct
cggcctccaaaacccagggccccacgcatatacgaggctcatgtaggaatgagtagttca
gaaccccgtgttaattcataccgagaatttgccgacgatgtcttgccccatatacaggca
aataattataacacagtccagttaatggctgtcatggagcattcttactatggatcattt
gggtatcatgttaccaacttttttgctgtaagcagtagatctggaactcctgaggatctc
aaatatttaattgacaaagcccacagcttgggtttacgtgtcttaatggatgttgttcac
agccatgcaagtaacaatgttactgatggtctcaatggctttgatgttgggcaaagctct
caggattcctattttcacactgcagatcgaggctaccataaattatgggacagccggctc
tttaattatgctaattgggaagttcttcgctttcttctgtccaatttaagatggtggctt
gaggagtacaaatttgacggttttcgatttgatggagtaacttcaatgttatatcatcac
catggaatcaacatggggttttcagggaattatattgagtatttcagtgaggcaactgat
gttgacgctgttgtttatttgatgcttgccaattctctgattcacaacctcttgccagat
gccactgtgattgccgaagatgtttctggcatgcctggacttagttgttctgtctctgag
gggggaattggttttgactatcgcctagcgatggccatccctgacaaatggattgattac
ttgaaaaacaagactgatgaagagtggtcaatgggagatatttcatggagcttaactaat
aggagatacacagagaaatgtgttgcttatgctgagagtcatgaccaagccattgtgggt
gacaagacaatcgccttcttactgatggatacagaaatgtattctgggatgtcttgcttg
acagatgctccacctactgttgaacgagggatagcacttcataagatgattcatctttta
acaatggcattaggaggtgagggctaccttaattttatgggaaatgagtttggccatccc
gagtggattgacttcccaagagaaggcaatggatggagttatgataagtgcagacgccaa
tggaatttagttgacaccgaacacttgagatataagttcatgaatgcatttgataaagct
atgaacttgcttgatgaaaagcattcgttcctttcatcaacgaagcagattgtaagcagc
acaaatgaagaagataaggctattgtctttgagcgtggggatctggtttttgtgtttaat
tttcatccagagaatacatatgatgggtacaaggttgggtgtgacttgccagggaagtat
aaagttgcattggatagtgatgcttgggaattcggtggacagggaagagtgggccatgat
gtagaccattttacgtctcctgaaggaatacctggagtgccggaaacaaatttcaacaat
cgtcctaactccttcaaagtactctccccacctcaaacatgtgtggcttactatagagtt
caagaaagccaagagagtaacaacagcatcaatccaggggccaggaatgagatatcaaca
gccgacgatgtgccaaagctgagggatattgaagtaggtatgaagcagacattagcagca
gatactggagcaaagcggggtgatttggaagaagttgtcaatcagacattagcatcagat
gctgcaactatgctggaggtcttcaaagaacctgctgatgataaggatactgaagaacct
actgtttctgttaagaaaggaaattcaaaagcacaagagatttga

DBGET integrated database retrieval system