KEGG   Ricinus communis (castor bean): RCOM_1602550Help
Entry
RCOM_1602550      CDS       T01087                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rcu00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 438 aa AA seqDB search
MGGVWWWRWCLILIFVIVTGVASATEEEPLLTRIAFGSCANQSAPQPIWNAIVDFDPQVF
IWLGDNIYGDIRRPFKIFGQERTIGPWKNAPRFIPSSHYEMESSYHQAKANPGYSRLRRT
AKVIGTWDDHDYGLNDAGKEFDRKVINQRLLLDFLDEPQDSPRRKQEGVYISYTFGPPTR
QIKVILLDTRYHRDPLRSDGSMLGSSQWTWLEKELNGPKTAITLIGSSVQVISNLSATTG
PLFYLESWGRFPKERKRLFKLIADSKREGIFFISGDVHFGEISRYDCATGYPLYDITSSG
LTQAVEKVVPSPLHFIVRFVAWLTPTTMRVMSQNCRFKSCTYGEPNFGAIEINWSAPVTV
KLEVRDMNGCPVTGVKFPLLELQSHGVDSMPSIKVQHQRHCTLEANLPWIVRYRLAILFY
LSVSGMCFDTSSVLIHPA
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgtttggtggtggagatggtgtctgatattaatatttgtaattgtaaccggt
gtcgcttctgctacagaagaggagccactgctcacccgaatagcttttggatcatgcgcc
aatcaaagcgctcctcagcccatctggaatgcaattgttgactttgatccccaagttttt
atttggttgggtgacaacatttatggagacatcaggcgcccttttaaaatttttggacaa
gaaaggacaattggtccatggaagaatgctcccaggttcattccttcctctcactatgaa
atggaatccagctaccaccaagctaaggctaatcctggttattctcgtcttcgacgcact
gctaaggtaattggcacctgggatgaccatgattatggattaaatgatgctggaaaagaa
tttgataggaaagtcattaaccagaggcttctcctcgatttcttagatgaacctcaagac
agtcctcggcgcaaacaggaaggtgtatatatatcttacacttttggccctccgaccaga
caaattaaggttattctcttagatacaagataccacagggatcctttgcgcagtgatgga
agtatgctcgggagttctcaatggacatggctagaaaaagagttgaatggaccaaaaaca
gccataaccctgattggatcttctgttcaggttatatcaaatctttcagcaaccactggt
ccactgttttatttggagtcttgggggcgttttccaaaggagaggaaacgcctatttaaa
ttgatagcagatagtaagagagaaggaatatttttcattagtggagatgttcattttgga
gaaatctcgagatatgattgtgctacgggatatccactgtatgatatcacctcaagtgga
cttacccaagctgttgagaaggtagtcccatcaccattgcatttcatagtgagatttgtt
gcttggttgacaccgactactatgagagtaatgagtcaaaactgcagattcaaatcatgt
acttatggtgaacccaattttggagcaattgaaataaactggagtgctcctgtgactgtg
aaactggaagtgagggacatgaatggatgccctgttactggtgtaaagtttccattattg
gagctgcaatcacatggtgtggactcgatgccttccattaaagtacagcatcaaaggcac
tgcactcttgaagcaaatttgccatggatcgtcagatatcgcctggccattttgttctat
ttgtctgtgtctggtatgtgttttgatacttccagtgtccttatccatcctgcttga

DBGET integrated database retrieval system