KEGG   Ricinus communis (castor bean): RCOM_1607830Help
Entry
RCOM_1607830      CDS       T01087                                 

Definition
triacylglycerol lipase, putative
Orthology
K16818  
phospholipase A1 [EC:3.1.1.32]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Glycerophospholipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    RCOM_1607830
   00592 alpha-Linolenic acid metabolism
    RCOM_1607830
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.32  phospholipase A1
     RCOM_1607830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 446 aa AA seqDB search
MQLSLVPPVPSSLSSTISTHLKVQCCTLTQPIKLDKKSMEINRPLKNWEHLLDPVYNNST
SSCSASQRPVKLGSKWMEYQGIRNWEGLLNPLDDNLRAEILRYGNFVEAAYNSFDFDPSS
PAYATCRFQKSTLLERSGLPQTGYRLTKHLRATSGIQLPRWIEKAPSWVATQSSWIGYVA
VCQDKEEISRLGRRDVVISYRGTATCLEWLENLRATLANIPDANSETETSGPCSCGPMVE
SGFLSLYTSRTAMGPSLQEMVREEIQRLLQSYGDEPLSLTITGHSLGAALAILTAYDIKT
TFRSAPLVTVISFGGPRVGNRSFRQHLEKQGTKVLRIVNSDDLITKVPGFVIDGDNDNEN
EVIKKRDVNIAGIPGWIQKRVEETQWAYAEVGKELRLSSKDSPYINSVNVATCHELKTYL
HLVNGFVSSSCPFRATAKRVLSKHRR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcagctctctctagtacctccagttccatcttcactctcttcgacaatctcaacacac
ttaaaagtacagtgctgcactctcacccaacctataaaactcgacaagaagtctatggag
atcaaccgacctctcaagaactgggaacaccttcttgatccagtttacaacaactcaacg
tcgtcctgctctgcctctcaaagacccgttaaactgggcagcaaatggatggaatatcag
ggtattcgaaactgggaaggtttactcaaccctctcgatgataatttacgtgcagagatt
ctccgatacggaaactttgttgaagcagcatacaattctttcgactttgatccttcatca
cctgcctatgccacctgtcgcttccaaaaaagtacattgctcgagcggtctggtttgcct
caaaccggttaccggttaaccaaacacttacgtgctacctcaggtatccaactgccacgt
tggatagaaaaagccccaagctgggtggcaactcagtctagctggataggctacgtggca
gtctgtcaagacaaggaggagatttcaaggttaggacgacgagatgtggtgatttcttac
agaggtactgctacttgcctcgaatggctcgaaaatttacgagccaccctggctaacata
cctgatgccaattctgagacagagacgagcggcccctgttcatgcggaccaatggtggaa
agtggattcttaagcctttatacttctagaacagcaatgggcccaagcctccaagaaatg
gtccgcgaagaaatccaaagacttctacaatcttacggcgacgagcctcttagcttaacc
attacaggccacagtctcggtgctgctctagcaattctcactgcttatgacatcaaaact
acattcagaagtgcaccgcttgtcaccgtcatatcttttggcggtccgcgagtcggaaac
aggagcttccgacaacatttagaaaaacaaggcacgaaagtgcttcgtattgtgaattct
gatgatctaataacaaaagtacctggttttgtaatcgatggagacaatgacaatgagaat
gaagttataaagaagagagacgtgaacatcgccggaattcctggctggatccagaaaaga
gtggaggagacacagtgggcatatgcggaggtcggaaaagaactcagattgagtagcaaa
gactctccgtacataaatagtgtgaacgtggccacgtgccatgagctgaaaacgtaccta
cacttggtgaatggattcgtaagctcatcttgtccatttagagcaaccgccaagagagtc
cttagtaaacatagaagataa

DBGET integrated database retrieval system