KEGG   Ricinus communis (castor bean): RCOM_1608620Help
Entry
RCOM_1608620      CDS       T01087                                 

Definition
Palmitoyl-protein thioesterase 1 precursor, putative (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    RCOM_1608620
  Lipid metabolism
   00062 Fatty acid elongation
    RCOM_1608620
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     RCOM_1608620
Lipid biosynthesis proteins [BR:rcu01004]
 Fatty acid synthase
  Component type
   RCOM_1608620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MASIPISFINVIVTLFFTFTLIPLTHSVPFIVLHGIGDKCSNRGISHFTELLGNWSGAPG
YCLEIGDGSLDSWTIPLLEQTALACEKVKNMSELADGYNIVGLSQGNMVGRGIIEFCEGG
PPVKNFVSLGGPHAGTASVPFCGSSTICILVDILIRLEVYSSYVQEHLAPSGYVKIPTDI
ADYLKGCKFLPRLNNEIIQNSTYKERLTSLENLVLIMFEQDTVLIPKETSWFGYYPDGAF
SPVLPVQETKLYTEDWIGLKTLDEAGKVKFLTVSGNHLQISQDVMKKYIVPYLEDQASYN
QIMEGASSFRWISSIGNFFRQQFGFAEGQTMLHVQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcttctattccaatctcctttatcaatgttatcgtaacacttttcttcactttcact
ctcatcccactcacccattctgttcccttcattgttttgcacggtattggagataaatgc
agtaatcggggaatatcacatttcactgagcttttaggcaactggtctggagctccagga
tattgcctagaaattggagatgggtcattggattcttggactataccccttcttgagcag
acagcacttgcttgtgagaaggtaaagaatatgagtgaacttgccgatggctacaacata
gttgggctatctcagggtaacatggttggtcgaggaattattgaattttgtgaaggagga
cctcctgttaagaattttgtttcactgggaggtccccatgctggtactgcttcagtgcca
ttctgtggatctagcaccatatgcattcttgtggacattttaatccggttagaggtctac
agcagctatgtccaggaacacttggctcctagtggttatgtcaaaatcccaactgacatt
gctgactacctaaaggggtgcaagtttcttcccagacttaacaatgaaatcatccaaaat
tctacttacaaggaacggttgactagcttagaaaatttggttttaataatgtttgagcag
gacacagttttgattccaaaggaaacctcctggtttgggtattatccagatggggccttc
tctcctgttctgcccgtacaggagactaagctctatactgaagactggattggtttgaaa
acactggatgaagctggaaaggtcaaattccttactgtgtccggaaatcacctccaaatc
tctcaagacgttatgaaaaaatacatagtgccttatttggaggaccaggcatcatacaat
cagataatggaaggcgcttcatcttttagatggatatcctcaattgggaacttctttcgc
caacaatttggttttgccgagggtcaaacaatgctgcatgttcaataa

DBGET integrated database retrieval system