KEGG   Ricinus communis (castor bean): RCOM_1608620Help
Entry
RCOM_1608620      CDS       T01087                                 

Definition
Palmitoyl-protein thioesterase 1 precursor, putative (EC:3.1.2.22)
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:rcu01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:rcu00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 335 aa AA seqDB search
MASIPISFINVIVTLFFTFTLIPLTHSVPFIVLHGIGDKCSNRGISHFTELLGNWSGAPG
YCLEIGDGSLDSWTIPLLEQTALACEKVKNMSELADGYNIVGLSQGNMVGRGIIEFCEGG
PPVKNFVSLGGPHAGTASVPFCGSSTICILVDILIRLEVYSSYVQEHLAPSGYVKIPTDI
ADYLKGCKFLPRLNNEIIQNSTYKERLTSLENLVLIMFEQDTVLIPKETSWFGYYPDGAF
SPVLPVQETKLYTEDWIGLKTLDEAGKVKFLTVSGNHLQISQDVMKKYIVPYLEDQASYN
QIMEGASSFRWISSIGNFFRQQFGFAEGQTMLHVQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggcttctattccaatctcctttatcaatgttatcgtaacacttttcttcactttcact
ctcatcccactcacccattctgttcccttcattgttttgcacggtattggagataaatgc
agtaatcggggaatatcacatttcactgagcttttaggcaactggtctggagctccagga
tattgcctagaaattggagatgggtcattggattcttggactataccccttcttgagcag
acagcacttgcttgtgagaaggtaaagaatatgagtgaacttgccgatggctacaacata
gttgggctatctcagggtaacatggttggtcgaggaattattgaattttgtgaaggagga
cctcctgttaagaattttgtttcactgggaggtccccatgctggtactgcttcagtgcca
ttctgtggatctagcaccatatgcattcttgtggacattttaatccggttagaggtctac
agcagctatgtccaggaacacttggctcctagtggttatgtcaaaatcccaactgacatt
gctgactacctaaaggggtgcaagtttcttcccagacttaacaatgaaatcatccaaaat
tctacttacaaggaacggttgactagcttagaaaatttggttttaataatgtttgagcag
gacacagttttgattccaaaggaaacctcctggtttgggtattatccagatggggccttc
tctcctgttctgcccgtacaggagactaagctctatactgaagactggattggtttgaaa
acactggatgaagctggaaaggtcaaattccttactgtgtccggaaatcacctccaaatc
tctcaagacgttatgaaaaaatacatagtgccttatttggaggaccaggcatcatacaat
cagataatggaaggcgcttcatcttttagatggatatcctcaattgggaacttctttcgc
caacaatttggttttgccgagggtcaaacaatgctgcatgttcaataa

DBGET integrated database retrieval system