KEGG   Ricinus communis (castor bean): RCOM_1611220Help
Entry
RCOM_1611220      CDS       T01087                                 

Definition
arginase, putative (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rcu01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rcu00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 338 aa AA seqDB search
MTVIGRRGIHYLQKLKAANIPAELIEKGQNRVIDASLTLIRERAKLKGELVRALGGAKAS
SSLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSTTEEGKELNDPRVLTDVGDVPVQE
IRDCSVDDDRLMNVISESVKLVMEEDPLRPLVLGGDHSISFPVVRAVSEKLGGPVDILHL
DAHPDIYHAFEGNKYSHASSFARIMEGGYARRLLQVGIRSITKEGREQGKKYGVEQFEMR
TFSRDRQFLENLKLGEGVKGVYISIDVDCLDPAFAPGVSHIEPGGLSFRDVLNILHNLQA
DVVAADVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgactgttatagggaggagaggaattcattatttgcagaaactaaaagcagcgaatata
cctgccgagttgatagaaaaaggccagaatcgtgtaatcgatgcttctcttactcttata
cgggagagagcaaagcttaagggagagcttgtgcgtgctctaggaggtgctaaagcatca
tcctctcttctaggagtacctctagggcataattcatcatttcttcaaggccctgctttt
gctcctcctcgaattagagaagctatatggtgtggtagcactaattcaactactgaagaa
gggaaagaactaaatgacccaagggtgctcactgatgttggtgatgtccctgtccaagaa
attcgagattgtagtgtagatgatgataggctgatgaacgttatcagcgagtctgtcaag
ttggtgatggaagaggatccattgcgtccattagttttaggtggtgatcattcaatatct
tttcctgtagtacgagctgtttctgagaagcttggtggacctgtggatattctccatctg
gatgctcatcctgacatctatcatgcttttgaaggaaataaatattctcatgcctcttca
tttgcccgaataatggaaggtggttatgcacggcgtctcttgcaagtgggtatccgatca
ataaccaaagaaggacgtgagcagggcaaaaagtatggagtggagcaatttgaaatgcga
accttctcaagagatcgccagttcttggaaaatctgaaattaggagaaggcgtcaagggg
gtgtatatctcgatagatgtggactgtcttgaccctgcctttgctcctggtgtatctcac
attgagcctggtggtctctctttccgtgatgttctcaacatcctccacaaccttcaagct
gacgttgttgcagctgatgtggttgaattcaatccacagcgtgacaccgttgacggtatg
actgcaatggttgctgccaagctggtgagagaactgactgcaaagatatcaaaatga

DBGET integrated database retrieval system