KEGG   Ricinus communis (castor bean): RCOM_1616300Help
Entry
RCOM_1616300      CDS       T01087                                 

Definition
big map kinase/bmk, putative (EC:2.7.11.24)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     RCOM_1616300
Protein kinases [BR:rcu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   RCOM_1616300
Exosome [BR:rcu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   RCOM_1616300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 370 aa AA seqDB search
MESSAGSSEHNVRGLPTHGGRYVQYNIYGNLFEVSRKYVPPIRPVGRGANGIVCAAKNAE
TQEEVAIKKIGNAFDNRIDAKRTLREIKLLRHMDHENIVAIKDIIRPPQKENFNDVYIVS
ELMDTDLHHIIRSNQSLTDDHCRYFLYQLLRGLKYVHSAHVLHRDLKPSNLLLNANCDLK
IADFGLARTTSETDFMTEYVVTRWYRAPELLLNCSEYTAAIDIWSVGCILGEIMTRQPLF
PGKDYVHQLRLITELIGSPDDNSLGFLRSDNARRYVRQLPQYPRKNFATRFPNMSSGAID
LLERMLVFDPNRRITVDEALCHPYLAPLHDINEEPVCPRPFNFDFEQPSFTEENIKELIW
RESVKFNPDP
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgagcgctggctccagcgagcataacgtaaggggactgccaactcacggtggt
cgttatgttcagtataatatttacggcaatctctttgaagtttctagaaagtatgtccct
cctattcgtcctgttggccgaggtgctaatggtattgtgtgtgctgctaaaaatgccgag
acgcaagaggaggttgccattaagaagattggtaatgctttcgacaaccgcatagatgct
aaaaggactttgcgagagattaagcttctccgccacatggatcatgaaaatattgttgct
atcaaagacatcatacgacctccccagaaggagaatttcaatgatgtctacattgtttct
gaattgatggatactgatcttcatcacataatacgttccaaccaatcattgacggatgat
cattgtcggtattttctctatcaattgctgcgagggctcaaatatgtacattcagcacat
gttttgcatcgtgacctaaagcctagcaatttgctcttgaatgctaattgtgaccttaag
attgcagactttggtcttgcaaggactacatctgaaacagattttatgaccgagtacgtt
gttactcgttggtatcgggcaccagaattactccttaattgttcagagtacactgcagca
attgatatatggtccgtgggttgtatactaggtgaaatcatgacacggcaaccattgttt
cctggcaaagattatgttcatcagctgagactaatcacagagctcataggttcaccagat
gacaacagccttggtttcctacgaagtgacaatgctcgaagatatgtgaggcagcttcca
caatacccaaggaaaaattttgctactagatttcctaatatgtcttcaggtgctatcgat
ctcttagagaggatgctagtctttgatccaaaccggcgcatcacagttgatgaggcgctg
tgccacccttacttagcacctcttcatgacatcaatgaggagcctgtttgcccaaggcct
ttcaactttgattttgagcaaccatcatttactgaggaaaatatcaaggagcttatctgg
agggaatccgtaaaattcaatccggatccttga

DBGET integrated database retrieval system