KEGG   Ricinus communis (castor bean): RCOM_1622040Help
Entry
RCOM_1622040      CDS       T01087                                 

Definition
Chorismate mutase, chloroplast precursor, putative (EC:5.4.99.5)
Orthology
K01850  
chorismate mutase [EC:5.4.99.5]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    RCOM_1622040
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    RCOM_1622040
Enzymes [BR:rcu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     RCOM_1622040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 358 aa AA seqDB search
MHIDFVCFSFIHYICSLCFCILLFLFSLCSIFLFSCSFKMEATLMIIVCASISCPKPTFF
SSPSSGLLHNHQKTPRFLNLKSKANRYCHLQASSSVPIRYLKDRVDESQSLSLESIRHSL
IRQEDSIIRSLLLRAQYCYNADTYDPDAFSMEGFNGSLVEFIVRETEKLHARVGRYKSPD
EHAYYPEHLPEPMLPPLRYPQVLHPSAGSININRKVWDGYFKDLLPELVKTGNDGNCGSA
AVYDTMCLQALSRRIHYGKFVAEAKFRESPAVYEAAIKKQDGKKLMELLTYEFVEAAVKK
RVEMKAKIFGRDITIASQVDEAEPIYKVQPSLVVNLFGNWIMPLTKEVQVEYLLRRLD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcatattgattttgtctgtttctcctttatccattatatttgtagcctttgtttctgc
attttgctatttctcttctctctttgctccatttttctattttcttgttcatttaaaatg
gaggcaacactaatgataattgtttgtgcttctatttcgtgcccaaagcctacatttttc
tcaagtcctagctcaggtctgcttcacaaccaccagaagacccctagatttcttaacttg
aaatctaaagctaatagatattgccatctccaagcatcttcatctgttcctattagatat
ttaaaggatagggtggatgagagccagagcttgagcctagaaagtatacgacattcacta
attcggcaagaggatagcattatacgcagccttttgctgagagcacaatattgttataat
gcagacacgtatgaccctgatgcgttttccatggaaggtttcaatgggtctttggttgaa
tttattgttagagaaactgaaaagctccatgctcgggttgggcgttacaagagtccagac
gagcatgcatattatcctgagcacttgccagagccaatgcttccccctttgcgttaccca
caggtcctgcatccctctgccggttcaataaatatcaacaggaaggtctgggatgggtat
tttaaagatcttcttccagaattggtcaaaaccggaaatgatggcaactgtgggtctgcc
gctgtttacgacaccatgtgcttgcaggcactgtcaaggagaattcactatggaaaattt
gtggcagaggctaaatttcgagaatcccctgctgtctatgaggctgctatcaagaagcaa
gatgggaagaaactaatggaattgctgacttatgaattcgtggaagcagcagttaagaag
agagtagagatgaaagcaaaaatatttggccgagacataacaattgcctcacaagttgat
gaagctgagcccatatataaagtgcagccaagtttagtcgtcaacctgtttggcaattgg
ataatgcccctcaccaaggaagttcaagttgaatacttgctgaggaggcttgattaa

DBGET integrated database retrieval system