KEGG   Ricinus communis (castor bean): RCOM_1653970Help
Entry
RCOM_1653970      CDS       T01087                                 

Definition
uricase, putative (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:rcu00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:rcu00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 374 aa AA seqDB search
MGSELDGFKFEQRHGKDRVRVTRVWRRNDGNHFMVEWSVSISLLSDCLNAYSRDDNSNIV
ATDTMKNTVYVKAKECTEQLSAENFAILLAQHFTSFYKEVTTAIIKIVEKPWERVSIDDQ
LHTHGFKLGSEKHTAEVTLTKSGDLQLTSGIVGLSVLKTTKSGFEGFIRDKYTALPETRE
RMLATEVTASWRYLYRSVSTIPQNPLYFTEKYLDVKKVLSNTFFGHPKEGVYSASVQCTL
FHMTKAVLNRFPDISSVQLKMPNLHFLPVNISSKDHNIVKFNDDVYLPTDEPHGSIEATL
SRFWGHVRKKLRIWNQNKRGDGACGIRTYKGGGGACGIETTHAGHSSTPGGDYSEREDGG
GGAGDGGHSGTDGD
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgggcagtgaattggatgggtttaagtttgagcagagacacggtaaggacagagttagg
gtgactagagtttggagaagaaacgatggtaatcatttcatggtggagtggagtgttagt
atcagcctcttatctgattgcctcaatgcatattcaagagatgataactctaatattgtt
gctactgataccatgaagaacacggtatatgtgaaagcaaaggaatgtacagaacaactt
tctgcagaaaactttgcaattttgctggctcagcacttcacttcattttacaaggaggta
actactgctatcataaagatagtagagaagccttgggagcgtgtaagcatagatgaccaa
ttgcatacacatggttttaaacttggatctgagaagcacacagcagaggtgacactaacg
aagtctggagacttacagctgacctctggcattgtgggactgtctgtactgaagacaacc
aagtcaggctttgaagggtttataagggataaatatacggctttgcctgaaacacgagag
aggatgctggcaacagaagtcactgcatcatggaggtatttgtatagatcagtctctacc
atccctcagaatccactttactttacagagaaatatttggatgtgaaaaaagttttgagc
aacactttctttggtcatcctaaggagggagtttacagcgcatctgttcagtgcactctt
tttcacatgacaaaggctgtactcaacaggtttcctgacatatcttcagtccaattgaaa
atgccaaatctccactttttacctgttaacatatcaagcaaggatcacaatattgtaaag
ttcaatgatgatgtatatttaccaacagatgagccacatggatcaatagaagcaactttg
agccgtttctggggtcatgtgcgaaagaaattgcgaatatggaatcagaataaaagagga
gacggggcatgtggaatcagaacatataaaggaggaggcggggcgtgtggaatagaaact
acgcatgcagggcactcttccactcccggtggtgattattcagagagagaagatggtggt
ggaggtgctggtgatgggggacattcagggactgatggggactga

DBGET integrated database retrieval system