KEGG   Ricinus communis (castor bean): RCOM_1678480Help
Entry
RCOM_1678480      CDS       T01087                                 

Definition
amine oxidase, putative (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    RCOM_1678480
Enzymes [BR:rcu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     RCOM_1678480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 511 aa AA seqDB search
MSSVIKEDRNPSHVKRVAVVGAGVSGLAAAYKLKSHGLKVTVFEAEERAGGKLRSVNHDG
LIWDEGANTMTESEMEVKSLIGNLGIREKQQFPISQNKRYIVRNGKPILIPTNPIALITS
NILSAQSKFQIILEPFLWKKRESSETHNAYTEESVGEFFQRHFGKEVVDYLIDPFVAGTS
AGDPESLSVCHSFPELWNLEKRFGSIIAGVVQAKLSTKRGKSQETKGSSVKKKQQRGSFS
FFGGMQTLTDTLCKALAKDELRLESKVFSLSYNPDSKSAVENWSLSYAFKGAKHLQNSSY
DAIVMTAPLCNVKEMKITKNRNIFSLNFLPEVSYMPLSVVITTFKKDNVKSPLEGFGVLV
PSKEQQNGLKTLGTLFSSMMFPDRAPNDLYLYTTFVGGSRNKELAKASTDDLKQIVTSDL
RQLLGAEGEPTFVNHFYWSKAFPLYGRNYDAVLEAIDTMEKDLPGFFYAGNHKGGLSVGK
AIASGCKAADLVISYLESSSDDKMLKEGPSN
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcagttatcaaagaagacagaaacccaagtcatgttaaaagagtagctgttgta
ggtgctggggttagtgggcttgctgcagcttacaaactgaaatcacatggcttgaaagtt
acagtatttgaagctgaagaaagagctggagggaagctgagaagcgttaaccatgatggt
ttaatttgggatgaaggtgcaaataccatgactgagagtgaaatggaggtcaaaagttta
attggcaatcttgggattcgtgaaaagcaacaatttccgatttcacagaacaaaaggtat
attgtaagaaatgggaagccaatattaatacccacaaatcccatcgcactgatcaccagc
aacattctctctgcacagtcaaagtttcaaatcattctggagccatttttgtggaagaaa
cgtgaatcttcagaaacgcacaatgcttatactgaggaaagtgttggtgagtttttccaa
cgtcattttggtaaagaggttgttgattatcttattgacccttttgttgcgggcactagt
gctggagatcctgaatctctttctgtatgccattcttttccagagctatggaatctggag
aaacgatttggatctattatagctggggtagttcaggcaaaattatctaccaaaagaggg
aagagccaagaaaccaaaggatcatcggtaaagaagaagcagcagcgtggttcattctct
ttttttggtggaatgcagacgctaactgatacattgtgcaaagcacttgcgaaggatgag
cttagattagaatcaaaggtcttctctttgtcttacaatcctgattctaagtcagcagta
gagaattggtcactttcttatgcttttaagggcgccaagcatttgcaaaactcatcttat
gatgctattgtcatgacggcaccattgtgcaatgttaaagaaatgaagatcacaaaaaac
agaaatatcttttcactgaattttcttcctgaggtgagttatatgccgctatcagttgtt
attaccacttttaagaaggataatgtcaagagcccccttgaaggctttggagttcttgtt
ccttctaaggagcaacagaatggtctaaaaacccttggtacactcttttcctctatgatg
tttccagatcgtgcacccaatgatctgtatctctatacaacctttgttggagggagtcga
aacaaggaactggcaaaagcttcaacggatgatctgaagcagattgttacctccgacctt
aggcaattgctaggagcagaaggcgagcccacatttgttaatcatttctactggagtaaa
gcatttccattatatgggaggaactatgatgcagtacttgaagccattgatacgatggaa
aaagatcttcctggattcttctatgcaggtaaccacaaaggtggactatcggttggcaaa
gcaatagcctctggatgcaaagcagctgatcttgtaatatcctatttggaatcttcttca
gatgacaagatgctgaaggaagggccatcaaattag

DBGET integrated database retrieval system