KEGG   Ricinus communis (castor bean): RCOM_1689260Help
Entry
RCOM_1689260      CDS       T01087                                 

Definition
serine/threonine protein phosphatase, putative (EC:3.1.3.16)
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
rcu  Ricinus communis (castor bean)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    RCOM_1689260
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     RCOM_1689260
Protein phosphatases and associated proteins [BR:rcu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     RCOM_1689260
Transcription machinery [BR:rcu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     RCOM_1689260
Spliceosome [BR:rcu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    RCOM_1689260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 320 aa AA seqDB search
MDETLLDDIIRRLVEAKNGRTTKQVQLTEAEIRHLCLASKEIFLSQPNLLELEAPIKICG
DVHGQFSDLLRLFEYGGYPPAANYLFLGDYVDRGKQSIETICLLLAYKVKYKENFFLLRG
NHECASINRIYGFYDECKRRFNVRIWKTFTDCFNCLPVAALIDEKILCMHGGLSPDLKNL
DQIRNIARPVDVPDQGLLCDLLWADPDKDIQGWGENDRGVSYTFGADKVAEFLQKHDLDL
VCRAHQVVEDGYEFFAKRQLVTIFSAPNYCGEFDNAGAMMSVDDTLTCSFQILKSSEKKG
KMGFGNNALRPGTPPHKGKG
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggacgagacgttacttgacgatattatacggcggttagtggaggcgaagaatggaagg
acaacgaagcaggtgcagttgacggaggcagaaatacggcatctttgtttagcgtcaaag
gagatttttcttagtcaacctaatcttcttgaacttgaagctcctattaagatttgtgga
gatgttcatggtcagttttcagatctcctacgattgttcgaatatggtgggtacccacct
gcagcaaactatttattcctaggggactatgttgatcgtggcaagcagagcatagagaca
atttgcctcctgcttgcatacaaggtcaaatacaaggagaacttcttcctcctgagggga
aaccatgaatgtgcttccatcaaccgtatatatggtttttatgacgagtgcaagagaagg
tttaatgttcgcatctggaagacattcactgattgctttaattgcctgcccgttgctgct
cttatagacgaaaagatcctttgcatgcatggtgggttatcccctgatctgaaaaacttg
gatcagatcaggaatatagctcgtcctgttgatgtgccagaccaaggccttctatgtgat
ttattgtgggctgatcccgataaagatatccaaggttggggagagaatgataggggggtg
tcatatacatttggggctgacaaggttgctgaattccttcagaaacatgaccttgatctt
gtgtgtcgggctcatcaggttgttgaggatggttacgagttttttgcaaagcggcagctg
gtcacaatattctctgcaccaaattactgtggtgagtttgataatgctggtgccatgatg
agcgtggatgatactttaacatgttcttttcaaattcttaaatcgtctgagaaaaaagga
aaaatgggatttggcaacaatgcattgagacctggaactccgccccataaggggaagggt
tga

DBGET integrated database retrieval system