KEGG   Ricinus communis (castor bean): RCOM_1692330Help
Entry
RCOM_1692330      CDS       T01087                                 

Definition
calcineurin B, putative
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
rcu  Ricinus communis (castor bean)
Brite
Protein phosphatases and associated proteins [BR:rcu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     RCOM_1692330
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 243 aa AA seqDB search
MRALKGCFSLKKSIKQEGYEDLIILASETPFTVNEIEALYNLFKKLSSTMIDDGLIHKEE
FQLALFRDSSKQNLFTDRVFDLFDVKRNGVIEFGEFVRSLSVFHPNASEADKTAFAFRLY
DLRGTGYIERDELKEMVLAVLSESDMLLSDDVVESIVDKTMAEGDSKRDGKIDLEEWQEF
VAKNPSLIKNMTLPYLKELTVAFPSFVLNTEIPDSGLDVVAIKDTRRYQILLRKEKNLSE
EVA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctcttaaaggctgctttagcttgaagaaatccataaagcaagaagggtatgag
gatcttatcatacttgcttctgaaacaccatttactgtaaatgaaattgaggctttgtat
aatctattcaagaagctgagcagtaccatgattgatgatggtcttattcacaaggaagaa
ttccaacttgcacttttcagagatagcagtaagcagaatcttttcacagatagggtgttt
gatctttttgatgtcaagcgcaatggggtaattgaatttggagaatttgttcggtcatta
agcgtcttccacccgaatgcttctgaagcagacaaaactgcatttgcatttagattgtac
gatctacggggaactggctacattgagcgtgatgagttgaaggagatggtattggctgtt
ctgagtgaatccgatatgttactttccgatgatgttgtcgaatctattgtagacaagaca
atggccgaaggagattcaaaaagagatggaaagattgatttagaagaatggcaggaattt
gtggcgaagaatccatctcttataaagaacatgactctaccatatcttaaggagctaact
gtagcatttcccagctttgtgctgaacactgaaattccagattccggactagacgtagtt
gccattaaagacactagaaggtatcaaattctcctccgaaaggagaaaaatttgagcgaa
gaagtggcatga

DBGET integrated database retrieval system