KEGG   Ricinus communis (castor bean): RCOM_1704650Help
Entry
RCOM_1704650      CDS       T01087                                 

Definition
fkbp-rapamycin associated protein, putative (EC:2.7.11.1)
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
rcu  Ricinus communis (castor bean)
Brite
Protein kinases [BR:rcu01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   RCOM_1704650
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1440 aa AA seqDB search
MVLPKSAIALPCGSDVIGGLLYDLIILNSKGNSIQKNDEIRKDAVDALCCLAHALGEDFT
IFIPSIHKLLLKHRLRHKEFEEFEGRLRRREPLILGSTAAQRLSRRLPVEVVSDPLNDAD
NDPYEDGTDGQRQLRGHQVNDGRLRTAGEASQRSTKEDWAEWMRHFSIELLKESPSPALR
TCARLAQLQPFLGRELFAAGFVSCWAQLNEGSQKQLVRSLEMAFSSPNIPPEILATLLNL
AEFMEHDEKPLPIDIRLLGALAEKCRAFAKALHYKEMEFEGARSKKMDANPVAVVEALIH
INNQLHQHEAAVGILTYAQQNLDVQLKESWYEKLQRWDDALKAYTAKAAQASSPHLVLEA
TLGRMRCLAALARWEELNNLCKEYWTPAEPSARLEMAPMAANAAWNMGEWDQMAEYVYRL
DDGDETKLRGLGNTAATGDGSSSGTFFRAVLLVRRGKYDEAREYVERARKCLATELAALV
LESYERAYSNMVRVQQLSELEEVIDYCTLPVGNPVAEGRRALIRNMWTERIQGAKRNVEV
WQTLLVVRALVLPPTEDIDTWLKFASLCRKNNRISQARSTLIKLLQYDPEKCPENVRYHG
PPQVMLAYLKYQWSLGEDHKRKEAFSRLQNLAIELSSSPNIHSVPPSGLMSGTSSNVPLL
ARVYLELGNWQWALSPGLDDDSIQEILAAFRNATQCATKWAKAWHTWALFNTAVMSHYTL
RGFPSVASQFVVAAVTGYFHSIACAANAKGVDDSLQDILRLLTLWFNHGATAEVQMALQK
GFAHVNINTWLVVLPQIIARIHSNNHAVRELIQSLLVRIGQSHPQALMYPLLVACKSISN
LRKAAAQEVVDKVRQHSGVLVDQAQLVSKELIRVAILWHEMWHEGLEEASRLYFGEHNIE
GMLKVLEPLHEMLEEGAMREDTTIKERAFIEAYRHELLEAWECCMNYRRTVKEAELTQAW
DLYYHVFRRIDKQLQTLTTLDLQSVSPELLECRNLELAVPGTYRADLPVVTIASFARQLV
VITSKQRPRKLTIHGSDGEDYAFLLKGHEDLRQDERVMQLFGLVNTLLENSRKTSEKDLS
IQRYDVIPLSPNSGLIEWVPHCDTLHQLIREYRDARKITLNQEHKYMLSFAPDYDHLPLI
AKVEVFEYALQNTEGNDLARVLWLKSRTSEVWLERRTNYTRSLAVMSMVGYLLGLGDRHP
SNLMLHRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVKAMEVSGIEGNFRSTCE
NVMQVLRINKDSVMAMMEAFVHDPLINWRLFNFNEVPQMSMFANTHAPAVVNAEESAPNR
ELPQPQRGARERELLLAVNQLGDANEVLNERAVVVMARMSNKLTGRDFSPSSSISASSIQ
HAVDHSSLISGDTREVDHALSVKLQVQKLIIQASSHENLCQNYVGYLANRLYCRAHLNKV
NT seq 4323 nt NT seq  +upstreamnt  +downstreamnt
atggttttacctaaatctgctattgctttaccttgtgggagtgatgtcataggagggctg
ctgtatgatttaatcatcttaaacagcaaaggaaactctatacagaagaatgatgagatc
aggaaagacgctgttgatgcactttgttgtttagcacatgctcttggggaagacttcacc
attttcatcccatcaattcacaaacttttgttgaagcatcgattacggcataaagaattt
gaagaatttgaaggacgtttacggaggcgtgaacctctgatcttggggagcacagctgca
caaagattgagccgacgacttccagtggaggttgtaagtgaccccttaaatgatgcagac
aatgatccttacgaagatgggaccgatggacaaaggcaacttagaggacatcaggtcaat
gatggtcggttgcgcacagctggagaggcttctcagcgcagtaccaaggaagattgggca
gaatggatgaggcatttcagcattgaacttctaaaggagtcaccatctccagcattacga
acttgtgccaggcttgcacaactacagccttttcttgggcgggagttgtttgctgctggt
ttcgttagctgttgggcacaactgaatgagggtagtcagaaacagttggttcgaagtttg
gagatggcattttcatctccaaatattcctcctgaaattctagcaacacttcttaacttg
gcagagtttatggagcatgacgagaagcctcttccaattgatatccgtctgcttggtgct
cttgcagaaaagtgtcgtgcatttgcaaaggctctgcattacaaagaaatggagtttgaa
ggtgctcgctcaaagaagatggatgctaatcctgttgctgtagttgaagctcttatacat
ataaataatcagttgcatcagcatgaggctgctgttggaatactaacatatgcccaacaa
aatcttgatgtccaattgaaggagtcctggtatgagaaattgcagcggtgggatgatgct
ctcaaagcatacactgcaaaagctgctcaagcatcaagtcctcatcttgtcttggaagct
acactaggaaggatgcgatgtcttgctgcactagctcggtgggaagagcttaacaaccta
tgcaaggaatattggactccagcagagccatctgcccgattagaaatggcaccaatggct
gctaatgctgcttggaacatgggagagtgggatcaaatggcagaatatgtttatcggttg
gatgatggtgatgaaactaaactccggggtttgggtaatactgctgctactggtgatgga
agtagcagtggtacattcttcagggctgttttattagttcgtagaggaaagtatgatgaa
gctcgggagtatgttgagagagctagaaagtgcttagcaacagaacttgctgctttggtt
ttagagagctatgaacgtgcctacagtaatatggtccgagttcagcagttgtcagaactg
gaggaggtaattgactattgtactcttcctgtgggaaatccagtggctgaaggacgacgg
gcccttattcgcaatatgtggactgagcgaattcaaggagcaaaacgtaatgttgaggtc
tggcaaactcttttggttgtaagagcactggtgcttcccccaactgaagacattgacaca
tggctcaaatttgcttctctttgtcggaaaaataatcgaattagtcaggctagatcaact
ttgattaaactcttgcagtatgaccctgagaaatgtcccgaaaatgtgagataccatggg
cctcctcaagtaatgctcgcatacttgaaatatcaatggtcacttggggaagatcacaag
agaaaagaagcattttctagactacagaatttggcgatagagctttcgagttccccaaat
attcactctgttccaccttctggtttaatgagcggtacaagttcaaatgtcccccttctt
gctcgtgtctatcttgaacttggaaactggcagtgggcactttctcctggactggatgat
gattccatacaagaaatccttgctgcattcaggaatgccacacagtgtgcaacaaaatgg
gccaaagcatggcatacttgggctttattcaatacagcagtgatgtctcattatactctt
agagggtttccaagtgttgcttcacaatttgttgttgcagctgtcactgggtattttcat
tcaatagcttgtgcagcaaatgctaaaggggtggatgatagcttacaggatatacttcgt
cttcttactttatggttcaaccatggagctactgcagaagttcaaatggcactgcagaaa
ggatttgcgcatgttaatatcaacacatggctggttgtgttacctcaaataattgccagg
atacattcaaataaccatgctgtgagagaactaatacaatcacttttggtgcgaattggg
caaagtcatccccaggcacttatgtatcctcttcttgtagcatgtaaatccataagcaat
ttgcgtaaagctgctgctcaagaagtggttgacaaagttaggcagcatagtggtgtactt
gtggatcaggcacaacttgtatcaaaggaactaatcagggttgcaatactttggcatgaa
atgtggcatgagggactggaagaagccagtcgcttgtattttggtgaacataacattgag
ggtatgctgaaggtcttggagcctttgcatgaaatgcttgaggaaggtgctatgagggag
gataccaccataaaggagagagcattcatcgaggcatatcgacatgaattgttagaggct
tgggaatgttgcatgaattacaggagaaccgtaaaggaggctgagcttacccaggcatgg
gatctttattaccatgttttcagacggatagacaagcagcttcaaacccttactaccctg
gacctgcagtctgtttctccggagctgttagaatgccgtaatttggagcttgctgttcct
gggacatatcgtgctgatttaccagtagtgacaattgcatcatttgcacgccagcttgtt
gttataacatctaaacagcgaccccgaaagttgactatccatgggagtgatggggaagat
tatgcttttttgctgaagggacatgaagatctgcgccaagatgaacgtgtgatgcagcta
tttggtttggtaaatacccttctggagaattcaagaaaaacttctgagaaggatctctct
attcaacggtatgatgtcattccattatctccaaatagtgggttaattgaatgggttcca
cactgcgacaccctacaccaactcattcgagagtacagggatgccaggaagattactttg
aaccaagagcacaaatatatgctcagttttgctccagattatgatcatttaccactcata
gctaaggtggaagtgtttgaatacgctttgcaaaatactgaaggaaatgacctagcaagg
gttctttggttaaagagtcgcacttctgaggtatggctggagaggaggacaaattataca
agaagtttagcagtcatgagtatggtgggttaccttcttggcttaggagatcgacaccca
agtaacctgatgcttcaccgctatagtgggaagatcttgcacattgactttggagactgt
tttgaagcttcaatgaaccgggagaagttccctgaaaaggtacctttccgtttgacgaga
atgcttgtgaaagcaatggaggttagtggtatagaaggcaatttccgctcgacttgtgaa
aatgtgatgcaagttcttcggataaacaaggatagcgttatggccatgatggaggcattt
gtccatgatcctctcatcaattggcgtcttttcaacttcaatgaagttccccaaatgtca
atgtttgcaaacactcatgctcctgctgttgtaaatgctgaggaatctgctccaaacaga
gagctgccgcaacctcaacgcggtgctcgtgaaagggaacttcttctggctgttaatcag
cttggtgatgctaatgaggttttgaatgagcgtgctgtggttgttatggcgagaatgagt
aataaactcactggacgtgacttctctccatcatcttcaatttctgccagctctatccaa
catgcagtagaccatagctccttaatttcaggagatactcgtgaagtggatcatgcatta
tctgttaaattgcaagttcagaagctcattatacaagccagttcacatgaaaatttgtgc
cagaattatgttggctatttagccaaccgtctgtattgcagggcccacttgaacaaggta
tga

DBGET integrated database retrieval system