KEGG   Ricinus communis (castor bean): RCOM_1715710Help
Entry
RCOM_1715710      CDS       T01087                                 

Definition
ribokinase, putative (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    RCOM_1715710
Enzymes [BR:rcu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     RCOM_1715710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 389 aa AA seqDB search
MKGIAFSPANHCFLTKSQNLTNKQSVNSNPIQFINHQTQKTQNPLTRTNQFPSVATKSSK
NPLGPINTPPLVVVGSANADIYVEIDRLPKEGETVSAKNGQTLAGGKGANQAACGGKLSY
PTYFLGQVGEDVNGKLITDALKNRGVHLDYVRYVGDVPTGHAVVMLQSDGQNSIIIVGGA
NMNSWPEMLSDEDLMIVKNAGIILLQREIPDDINIQVAKAAKQAGVPVIFDAGGMDAPIP
SELLKFVDIFSPNETELARITGMPTENVEQIGQAVKKCHEMGVRQVLVKLGAQGSALFEE
GKKPIIQPIISAERVLDTTGAGDTFTAAFAVALVEGNTKEECMRFAAAAASLCVQVKGAI
PSMPDRTSVLDLLQAAAKSIITLCVRKMP
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggaatagctttttcacctgcaaatcattgtttcctcacaaaatctcagaacctc
actaacaaacagtcagtaaattcaaacccaattcaattcatcaatcaccaaactcaaaaa
acccaaaacccattaacaagaacaaaccaatttccatcagttgcaacaaagtcctccaaa
aaccctctggggccaatcaatacaccaccactagttgtggttggatcagctaatgcagac
atatatgtagaaattgacagactacccaaagaaggagagacagtttcagctaagaatgga
cagacacttgctggtggtaaaggagctaaccaagcagcatgtggtggcaaactttcttat
ccaacttactttttgggtcaagtgggtgaagatgtaaatgggaagttgatcactgatgct
ttaaagaatcgtggagttcaccttgattatgtaagatatgttggcgatgtccctactgga
catgctgttgtcatgcttcagtctgatggacagaattctattatcattgttggtggtgct
aacatgaattcttggcctgagatgttgagtgatgaggatttgatgattgtgaagaatgct
ggtattattctgctgcagagggaaatccctgatgacatcaatatccaagttgcaaaggct
gcaaagcaagcaggtgtgcctgttatttttgatgctgggggaatggatgcaccaatacct
tcagaactgttgaaatttgtcgacatctttagcccaaatgaaactgaacttgctcgtatc
actggcatgcccacagaaaatgttgaacagattggtcaagctgtcaaaaagtgtcatgaa
atgggagttaggcaagtcctagtgaaacttggggcccaagggtcggccttatttgaagag
gggaaaaaaccaattatacagcctattatatctgctgaaagggtgcttgacactacgggt
gctggagatacttttactgctgcttttgctgtcgctctggtggagggcaacacaaaagag
gaatgcatgagatttgctgctgcagcagcttctctttgcgttcaagtgaagggagcaatt
cctagcatgcctgaccggacatcggttctggatcttcttcaggctgcagccaagagtatt
attacattatgtgtcaggaaaatgccttaa

DBGET integrated database retrieval system