KEGG   Ricinus communis (castor bean): RCOM_1716540Help
Entry
RCOM_1716540      CDS       T01087                                 

Definition
cysteine-type endopeptidase, putative (EC:3.1.2.15)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.4.19.12]
Organism
rcu  Ricinus communis (castor bean)
Brite
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     RCOM_1716540
Peptidases [BR:rcu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   RCOM_1716540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 644 aa AA seqDB search
MGFELQMSWQPSLLSQKRKNRPPLGLRNLGNSCYLNSVLQCLTYTPPLANFCLRLQHSSL
CDSVSNGERKRECPFCILEKRIVRSLSLDLTLDAPAKIQSCLKIFAEHFKGGQQEDAHEF
LRYVIDACHNTCLRLMKLRRKGINSNNKNYDNDTTTSTSTSTSVVKEIFGGTLQSQVKCL
SCHSESNKVDEIMDISLDVLHSNSLREAMQKFFQPEILDGNNKYRCESCKKLVAARKQMS
ILQAPNILVIQLKRFEGIFGGKIDKAIAFEEVLVLSSFMCKGSQDPRPEYNLFGTIVHSG
YSPESGHYYAYIKDATGRWYCCNDSYVTLSTMQDVLSEKVYILFFSRSNQRPGSAGPSFT
PIKPCNPNGCEASNISKVTVSPNAVDAEASVEQPSRKDIPSMSKVDKVPSSPRVKFNIFG
NSLSKRILPTGDGKAESHKSQNMEMNGSMKDRVYVEKHDKDMPSTINGNGCNKSRKINDG
ETGQAITKASANGVTQNGASDSGKPCLYESNGSASTDKGPGQHKLQNGGVNCHSGIPELK
RKLKEDSCILIAQDAQSRTEVKELKEALKQEASTVLRSCGWSSKVYSFMCSRKRLCAREP
GNLPSDIDLKKLLIAEAKSTFISQIPESLKEDLVKRLQSFSQEK
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgggatttgaattgcagatgagttggcaaccgagtttactgagtcagaaaaggaaaaat
cgtcctcctttagggttaagaaacctcggcaactcttgctatctcaatagcgtccttcag
tgtctcacttacactcctcctctcgccaatttctgcctccggttacaacactcctctctc
tgtgattcggtttcgaacggtgagagaaagcgtgagtgtccgttttgtatattagagaaa
aggattgttaggtccttaagcctagacctgacactagatgctccggctaagatccagagc
tgtctcaagatttttgccgaacactttaagggcggtcaacaagaggatgcccatgaattc
ttgcgatatgttattgatgcttgccataacacttgcttgcggctcatgaagctgcggcgc
aagggaattaacagtaataataaaaattatgacaatgatacaactactagtactagtacg
agtactagtgttgttaaagagatatttgggggcactttgcaaagtcaagtgaagtgttta
tcgtgtcattctgagtcgaataaagttgatgagattatggatattagtcttgatgttttg
catagtaattcacttagagaagctatgcagaagttttttcagcctgagatcttggatgga
aacaacaagtatagatgtgaaagttgtaagaaattggtggcagcaaggaagcaaatgtct
attcttcaagcgcctaatatcttggtgatccaactaaagagatttgagggcatatttggt
ggcaagattgataaggctattgcatttgaagaagttttggtactgtcaagcttcatgtgc
aaaggaagccaggatccacggccagagtataatctttttggcaccattgtgcattcagga
tattcaccggaatctggacactactatgcatatatcaaggatgcaacgggtcggtggtat
tgctgcaatgattcatatgtgacgctttcaacaatgcaagatgtcttgtcagagaaggtc
tatattcttttcttctctcgcagtaaccaaagaccaggatctgcagggccctcttttact
cccataaaaccgtgtaatcccaatggctgcgaggcatctaacatttcaaaggttactgtt
tcacctaacgcagtggatgcagaggcatctgttgaacaaccttcacgcaaggatattcct
tccatgtctaaggttgataaagtgccttctagtccacgggtaaaatttaatatttttgga
aattccctttcaaagaggattctgccaactggtgacggaaaggctgaaagtcataagagt
caaaatatggaaatgaatgggagcatgaaagacagagtttatgtggagaaacatgacaaa
gatatgccatcaacaattaatggaaatggttgtaataagagtaggaagattaatgatggt
gagactggccaagcaattacaaaagcaagtgcaaatggtgtcacccaaaatggtgcttct
gattcaggaaagccgtgtctctatgagtctaacggtagcgcatcaacagacaaaggacct
ggtcaacataaattgcaaaatggtggagtgaattgccactctggcattccagagttgaag
agaaaattaaaggaggattcttgcattttgattgcacaggatgctcaatctcggactgaa
gtaaaagagttgaaagaagctctcaagcaagaagcttccacagttttgcgatcatgtggt
tggtctagtaaggtatacagttttatgtgttcaaggaagaggttatgtgcacgagaacca
ggaaatcttccaagtgatattgacttaaagaaactgttgatcgcagaggccaagtcaacc
tttatatcgcagatacctgaatcattgaaagaggatctagttaaacgtcttcagtcattt
agccaagagaagtga

DBGET integrated database retrieval system