KEGG   Ricinus communis (castor bean): RCOM_1882620Help
Entry
RCOM_1882620      CDS       T01087                                 

Definition
Alkaline phosphatase D precursor, putative (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
rcu  Ricinus communis (castor bean)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:rcu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    RCOM_1882620
Enzymes [BR:rcu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     RCOM_1882620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 329 aa AA seqDB search
MPDQNPPADHSRRRFLRDSAVTTVTTAAALASPAALSATPAAPAIVTSERLRPQLPGGVM
SGDVTRDSAILWARADRNARMLVEYSTSENFSNPVRIAGPTALAREDYTARVDLRDLPAG
QRLYYRVRFQDLVHESALSEPLTGSLMMPASAHGQARDITFAFSGDEAGQGWGINEQWGG
YRVYESMRRFRPDFFIHSGDQIYADGPIQAEVKLDDGSLWRNVVTEAKSKVAQTLDDYRG
NFAYNMLDANKRRFAAEVPFLVQWDDHEVRNNWYPGQEIGAAEKRYDERNIDVLAARARQ
AMFEHNPFRIDSADPFRIYRAFNHGPLLE
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccagaacccgccagccgaccacagccgccgccgcttcctgcgcgacagtgcg
gttaccaccgtcaccaccgccgccgcgcttgccagcccggccgcattgtccgccaccccg
gccgcaccggccatcgtcacttccgaacgcctgcgcccgcaattgccgggcggtgtcatg
agcggggatgtcacccgcgacagcgccatcctctgggcgcgggccgaccgcaatgcccgc
atgctggtcgagtattcgaccagcgagaacttctccaaccccgtccgtatcgccggtccc
acggcgctggcgcgggaggactacaccgcccgcgtggacctgcgcgacttgcctgccggc
cagcgcctgtattaccgcgtgcgcttccaggacctggtgcatgagtcggcgctgagcgag
ccgctcaccggcagtctcatgatgccagcctcagcgcacggccaggcgcgtgacatcacc
tttgccttctcgggcgatgaagccggccagggctggggcatcaacgagcagtggggcggt
tatcgcgtgtacgaaagcatgcgccgcttccgtccggatttcttcatccattcgggtgac
cagatctatgccgatggtccgatccaggctgaagtgaagctggacgatggcagcctgtgg
cgcaatgtggtgaccgaagccaagtccaaggtagcgcagacgctggacgactatcgcggc
aacttcgcctacaacatgctggacgccaacaagcgccgcttcgccgccgaggtgccgttc
ctggtgcagtgggacgaccacgaggtgcgcaacaactggtacccgggccaggagatcggc
gcggctgaaaagcgctacgacgaacgcaacattgatgtgctggccgcccgcgcgcgccag
gccatgttcgaacacaatcccttccgcatcgacagcgccgatcctttccgcatctatcgc
gcgttcaaccatgggccgctgctggaa

DBGET integrated database retrieval system